Property Summary

NCBI Gene PubMed Count 31
PubMed Score 7.31
PubTator Score 12.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 2.200 0.000
active Crohn's disease 1.254 0.017
ovarian cancer 1.100 0.000

Synonym

Accession Q9NZ20 O95768
Symbols SPLA2III
sPLA2-III
GIII-SPLA2

Gene

Gene RIF (21)

PMID Text
25964585 sPLA2GIII expression may be used as a risk factor for lymph node metastasis and a prognostic marker in colorectal cancer. In addition, sPLA2GIII and sPLA2GX may play opposing roles in colorectal carcinogenesis
25286228 Studies indicate that the expression of secreted phospholipases A2 (sPLA2s), most notably the group IIA, III and X enzymes, is dysregulated in various malignant tissues.
25230085 Studies indicate that phospholipase A2 receptor 1 (PLA2R1) may act as a clearance or signaling receptor for secreted phospholipase A2 (sPLA2s).
24508801 Data indicate that the expression of genes encoding hGIIA, hGIII and hGX sPLA2s (PLA2G2A, PLA2G3 and PLA2G10, respectively) in breast tumour biopsies differs from that in normal tissues.
20930276 we describe that PLA2G3 gene silencing produced a marked inhibition of xanthine/xanthine oxidase induced cell death, and that PLA2G3 polymorphisms are associated with Alzheimer disease in a Spanish case-control sample.
20930276 Observational study of gene-disease association. (HuGE Navigator)
20654644 The availability of the human group III phospholipase A(2) (hIIIPLA(2)) amino acid sequence offers an opportunity to study its structural features by modeling.
20492356 Secreted PLA2 III induces apoptosis of primary cortical neurons in culture by suppressing production of Bcl-xl, promoting Bax, augmenting caspase 3 and cleaving alpha-fodrin.
20198315 Observational study of gene-disease association. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MGVQAGLFGMLGFLGVALGGSPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHARWDAHRRLQS      1 - 70
CSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRALEESPAGARKKRAAGQSGVP     71 - 140
GGGHQREKRGWTMPGTLWCGVGDSAGNSSELGVFQGPDLCCREHDRCPQNISPLQYNYGIRNYRFHTISH    141 - 210
CDCDTRFQQCLQNQHDSISDIVGVAFFNVLEIPCFVLEEQEACVAWYWWGGCRMYGTVPLARLQPRTFYN    211 - 280
ASWSSRATSPTPSSRSPAPPKPRQKQHLRKGPPHQKGSKRPSKANTTALQDPMVSPRLDVAPTGLQGPQG    281 - 350
GLKPQGARWVCRSFRRHLDQCEHQIGPREIEFQLLNSAQEPLFHCNCTRRLARFLRLHSPPEVTNMLWEL    351 - 420
LGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPLRGPMSFYNQC    421 - 490
LQLTQAARRPDRQQKSWSQ                                                       491 - 509
//

Text Mined References (32)

PMID Year Title
25964585 2015 Phospholipase A2 Group III and Group X Have Opposing Associations with Prognosis in Colorectal Cancer.
25286228 2014 Secreted phospholipases A2 in cancer: diverse mechanisms of action.
25230085 2014 Emerging roles of secreted phospholipase A2 enzymes: the 3rd edition.
24692702 2014 Silibinin down-regulates expression of secreted phospholipase A2 enzymes in cancer cells.
24508801 2014 Secreted phospholipases A?are differentially expressed and epigenetically silenced in human breast cancer cells.
23793742 2013 Structural and phylogenetic basis for the classification of group III phospholipase A2.
23776197 2013 Genome-wide association study identifies ephrin type A receptors implicated in paclitaxel induced peripheral sensory neuropathy.
23685814 2013 PLA2G3 promotes mast cell maturation and function.
23624557 2013 Mast cell maturation is driven via a group III phospholipase A2-prostaglandin D2-DP1 receptor paracrine axis.
21848517 2011 T-cell and antibody responses to phospholipase A2 from different species show distinct cross-reactivity patterns.
More...