Property Summary

NCBI Gene PubMed Count 24
PubMed Score 163.28
PubTator Score 18.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia 1.100 3.9e-03
lung cancer -1.100 2.4e-03
medulloblastoma, large-cell -1.100 5.5e-03
osteosarcoma -1.687 1.7e-05
ovarian cancer 1.400 3.6e-05
psoriasis -1.700 3.1e-05
spina bifida -1.098 3.4e-02

 GO Function (1)

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (11)

AA Sequence

MASKKLGADFHGTFSYLDDVPFKTGDKFKTPAKVGLPIGFSLPDCLQVVREVQYDFSLEKKTIEWAEEIK      1 - 70
KIEEAEREAECKIAEAEAKVNSKSGPEGDSKMSFSKTHSTATMPPPINPILASLQHNSILTPTRVSSSAT     71 - 140
KQKVLSPPHIKADFNLADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQLLDNNLPRGGSGSVLQ    141 - 210
DEEVLASLERATLDFKPLHKPNGFITLPQLGNCEKMSLSSKVSLPPIPAVSNIKSLSFPKLDSDDSNQKT    211 - 280
AKLASTFHSTSCLRNGTFQNSLKPSTQSSASELNGHHTLGLSALNLDSGTEMPALTSSQMPSLSVLSVCT    281 - 350
EESSPPNTGPTVTPPNFSVSQVPNMPSCPQAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENI    351 - 420
EQILDYLFAHGQLCEKGFDPLLVEEALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDN    421 - 490
ALEDLMARAGAS                                                              491 - 502
//

Text Mined References (27)

PMID Year Title