Property Summary

NCBI Gene PubMed Count 133
Grant Count 63
R01 Count 19
Funding $12,255,664.4
PubMed Score 198.74
PubTator Score 161.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
psoriasis 2.500 0.001
Multiple myeloma 1.432 0.005
malignant mesothelioma 1.900 0.000
esophageal adenocarcinoma 1.100 0.041
osteosarcoma -1.457 0.000
posterior fossa group A ependymoma 1.700 0.000
glioblastoma 1.500 0.000
cystic fibrosis -2.700 0.001
astrocytoma 1.500 0.028
atypical teratoid / rhabdoid tumor 1.400 0.000
tuberculosis 1.300 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.003
lung cancer -1.800 0.000
active Crohn's disease 1.491 0.027
active ulcerative colitis 1.578 0.013
diabetes mellitus -1.100 0.013
pediatric high grade glioma 1.300 0.000
pilocytic astrocytoma 1.600 0.000
non primary Sjogren syndrome sicca -1.200 0.025
breast carcinoma -1.200 0.000
Breast cancer -1.800 0.000
ductal carcinoma in situ -1.400 0.004
invasive ductal carcinoma -1.700 0.017
ovarian cancer 2.000 0.000

Synonym

Accession Q9NZ08 O60278 Q6UWY6 Q8NEL4 Q8TAD0 Q9UHF8 Q9UKY2
Symbols ALAP
A-LAP
ARTS1
ERAAP
APPILS
ARTS-1
ERAAP1
PILSAP
PILS-AP

Gene

PANTHER Protein Class (3)

PDB

2YD0   3MDJ   3QNF   3RJO  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
652197 screening 500 / 0 / 338637 MLPCN ERAP1 Measured in Biochemical System Using Plate Reader - 7016-01_Inhibitor_SinglePoint_HTS_Activity
652221 summary 0 / 0 / 0 Broad Institute Small Molecule Probes of ERAP-1 Inhibitor Probe Project
743314 confirmatory 95 / 59 / 271 MLPCN ERAP1 Measured in Biochemical System Using Plate Reader - 7016-01_Inhibitor_Dose_CherryPick_Activity_Set2
743317 confirmatory 95 / 81 / 249 MLPCN ERAP1 Measured in Biochemical System Using Plate Reader - 7016-01_Inhibitor_Dose_CherryPick_Activity

Gene RIF (123)

PMID Text
26399368 beta2i/MECL-1 and PA28 negatively affect C- and N-terminal cleavage and therefore epitope liberation from the proteasome, whereas ERAP1 destroys the MART-1(26-35) epitope by overtrimming activity
26393469 rs1065407 and rs10050860 of the ERAP1 gene may contribute to the genetic susceptibility of BD by modulating the expression of ERAP1.
26360328 ERAP-1 has a significant influence on the B*51:01 peptidome and its affinity which provides a mechanism for the epistatic association of ERAP-1 and B*51:01 in Behcet's disease.
26321090 KIR3DL1 interaction with HLA-B27 is altered by ankylosing spondylitis associated ERAP1 and enhanced by MHC class I cross-linking
26224046 two of the most consistently discovered disease-associated polymorphisms, namely K528R and Q730E of ERAP1, were analyzed for their effect on the ability of the enzyme to select substrates based on length and to undergo conformational changes.
26146606 ERAP1 downregulation is associated with loss of heterozygosity.
26130142 Silencing or inhibition of endoplasmic reticulum aminopeptidase 1 (ERAP1) suppresses free heavy chain expression and Th17 responses in ankylosing spondylitis.
26097239 CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 are bona fide susceptibility genes for Behcet's disease.
26002026 Genetic variants and haplotypes of ERAP1 are associated with ankylosing spondylitis, psoriasis, and Behcet's disease in people of varying ancestries.
25994336 epistatic interaction between ERAP1 and the HLA class I alleles HLA-B*27 and HLA-B*40:01 affects susceptibility to ankylosing spondylitits
More...

AA Sequence

MVFLPLKWSLATMSFLLSSLLALLTVSTPSWCQSTEASPKRSDGTPFPWNKIRLPEYVIPVHYDLLIHAN      1 - 70
LTTLTFWGTTKVEITASQPTSTIILHSHHLQISRATLRKGAGERLSEEPLQVLEHPRQEQIALLAPEPLL     71 - 140
VGLPYTVVIHYAGNLSETFHGFYKSTYRTKEGELRILASTQFEPTAARMAFPCFDEPAFKASFSIKIRRE    141 - 210
PRHLAISNMPLVKSVTVAEGLIEDHFDVTVKMSTYLVAFIISDFESVSKITKSGVKVSVYAVPDKINQAD    211 - 280
YALDAAVTLLEFYEDYFSIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMT    281 - 350
VAHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVGDYFFGKCFDAMEVDALNSSHPVS    351 - 420
TPVENPAQIREMFDDVSYDKGACILNMLREYLSADAFKSGIVQYLQKHSYKNTKNEDLWDSMASICPTDG    421 - 490
VKGMDGFCSRSQHSSSSSHWHQEGVDVKTMMNTWTLQKGFPLITITVRGRNVHMKQEHYMKGSDGAPDTG    491 - 560
YLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIKFNVGMNGYYIVHYEDDGWDSLTGLLKGTHTA    561 - 630
VSSNDRASLINNAFQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFK    631 - 700
AFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLSLPVDVTLA    701 - 770
VFAVGAQSTEGWDFLYSKYQFSLSSTEKSQIEFALCRTQNKEKLQWLLDESFKGDKIKTQEFPQILTLIG    771 - 840
RNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQ    841 - 910
TIETIEENIGWMDKNFDKIRVWLQSEKLERM                                           911 - 941
//

Text Mined References (136)

PMID Year Title
26399368 2015 The proteasome immunosubunits, PA28 and ER-aminopeptidase 1 protect melanoma cells from efficient MART-126-35 -specific T-cell recognition.
26393469 2015 Association of ERAP1 Gene Polymorphisms With Behçet's Disease in Han Chinese.
26360328 2016 The Peptidome of Behçet's Disease-Associated HLA-B*51:01 Includes Two Subpeptidomes Differentially Shaped by Endoplasmic Reticulum Aminopeptidase 1.
26321090 KIR3DL1 interaction with HLA-B27 is altered by ankylosing spondylitis associated ERAP1 and enhanced by MHC class I cross-linking.
26224046 2015 Effects of polymorphic variation on the mechanism of Endoplasmic Reticulum Aminopeptidase 1.
26146606 2015 Molecular backgrounds of ERAP1 downregulation in cervical carcinoma.
26130142 2016 Silencing or inhibition of endoplasmic reticulum aminopeptidase 1 (ERAP1) suppresses free heavy chain expression and Th17 responses in ankylosing spondylitis.
26097239 2015 Brief report: association of CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 With Behçet's disease in Iranians.
26002026 2015 Endoplasmic reticulum-associated amino-peptidase 1 and rheumatic disease: genetics.
25994336 2015 Major histocompatibility complex associations of ankylosing spondylitis are complex and involve further epistasis with ERAP1.
More...