Property Summary

NCBI Gene PubMed Count 13
Grant Count 78
R01 Count 11
Funding $7,011,292.42
PubMed Score 380.46
PubTator Score 109.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic cancer -1.300 0.028
osteosarcoma 1.506 0.001
pancreatic carcinoma -1.300 0.028

Synonym

Accession Q9NZ01 B2RD55 O75350 Q6IBB2 Q9BWK3 Q9Y6P0
Symbols SC2
TER
GPSN2
MRT14

Gene

PANTHER Protein Class (2)

PDB

2DZJ  

Gene RIF (5)

PMID Text
25049234 Data indicate that trans-2-enoyl-CoA reductase TER is involved in both very long-chain fatty acids (VLCFAs) synthesis and sphingosine degradation within sphingolipids.
24220030 P182L mutation reduces the activity and stability of the TECR enzyme.
21212097 Exome sequencing reveals a novel mutation for autosomal recessive non-syndromic mental retardation in the TECR gene on chromosome 19p13.
18976975 Knockdown of trans-2,3-enoyl-CoA reductase (TECR) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
15847654 Observational study of genetic testing. (HuGE Navigator)

AA Sequence

MKHYEVEILDAKTREKLCFLDKVEPHATIAEIKNLFTKTHPQWYPARQSLRLDPKGKSLKDEDVLQKLPV      1 - 70
GTTATLYFRDLGAQISWVTVFLTEYAGPLFIYLLFYFRVPFIYGHKYDFTSSRHTVVHLACICHSFHYIK     71 - 140
RLLETLFVHRFSHGTMPLRNIFKNCTYYWGFAAWMAYYINHPLYTPPTYGAQQVKLALAIFVICQLGNFS    141 - 210
IHMALRDLRPAGSKTRKIPYPTKNPFTWLFLLVSCPNYTYEVGSWIGFAIMTQCLPVALFSLVGFTQMTI    211 - 280
WAKGKHRSYLKEFRDYPPLRMPIIPFLL                                              281 - 308
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25049234 2014 Dual functions of the trans-2-enoyl-CoA reductase TER in the sphingosine 1-phosphate metabolic pathway and in fatty acid elongation.
24220030 2013 Mutation for nonsyndromic mental retardation in the trans-2-enoyl-CoA reductase TER gene involved in fatty acid elongation impairs the enzyme activity and stability, leading to change in sphingolipid profile.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
21212097 2011 Exome sequencing reveals a novel mutation for autosomal recessive non-syndromic mental retardation in the TECR gene on chromosome 19p13.
20937905 2010 ELOVL1 production of C24 acyl-CoAs is linked to C24 sphingolipid synthesis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
15847654 2005 A flexible array format for large-scale, rapid blood group DNA typing.
More...