Property Summary

NCBI Gene PubMed Count 13
PubMed Score 415.48
PubTator Score 109.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.506 1.1e-03
pancreatic cancer -1.300 2.8e-02
pancreatic carcinoma -1.300 2.8e-02

Gene RIF (5)

AA Sequence

MKHYEVEILDAKTREKLCFLDKVEPHATIAEIKNLFTKTHPQWYPARQSLRLDPKGKSLKDEDVLQKLPV      1 - 70
GTTATLYFRDLGAQISWVTVFLTEYAGPLFIYLLFYFRVPFIYGHKYDFTSSRHTVVHLACICHSFHYIK     71 - 140
RLLETLFVHRFSHGTMPLRNIFKNCTYYWGFAAWMAYYINHPLYTPPTYGAQQVKLALAIFVICQLGNFS    141 - 210
IHMALRDLRPAGSKTRKIPYPTKNPFTWLFLLVSCPNYTYEVGSWIGFAIMTQCLPVALFSLVGFTQMTI    211 - 280
WAKGKHRSYLKEFRDYPPLRMPIIPFLL                                              281 - 308
//

Text Mined References (17)

PMID Year Title