Property Summary

NCBI Gene PubMed Count 26
Grant Count 6
R01 Count 3
Funding $215,226.26
PubMed Score 25.71
PubTator Score 12.31

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26209226 Study identifies GTSE1 as a biomarker for cisplatin resistance in gastric cancer cells and suggests its repressive role in cisplatin induced apoptosis making it a potential therapeutic target for better clinical management of gastric cancer patients.
23236459 GTSE1 is a microtubule plus-end tracking protein that regulates EB1-dependent cell migration.
22292647 GTSE1 is overexpressed dramatically in lung cancer patients' tissues.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20577264 Data show that G2 and S-phase-expressed 1 (GTSE1) protein, a negative regulator of p53, is required for G2 checkpoint recovery and that Plk1 phosphorylation of GTSE1 promotes its nuclear localization.
20018861 hGTSE-1 mediated-p21(CIP1/WAF1) stabilization is clearly involved in the ability of cells to counteract cytotoxicity induced by the microtubule poison paclitaxel.
19913121 Observational study of gene-disease association. (HuGE Navigator)
14707141 requires an intact nuclear export signal and functional Mdm2 for the regulation of p53
12750368 GTSE-1 controls DNA damage-induced apoptosis by affecting p53 function

AA Sequence

MDDPKKEDILLLADEKFDFDLSLSSSSANEDDEVFFGPFGHKERCIAASLELNNPVPEQPPLPTSESPFA      1 - 70
WSPLAGEKFVEVYKEAHLLALHIESSSRNQAAQAAKPEDPRSQGVERFIQESKLKINLFEKEKEMKKSPT     71 - 140
SLKRETYYLSDSPLLGPPVGEPRLLASSPALPSSGAQARLTRAPGPPHSAHALPRESCTAHAASQAATQR    141 - 210
KPGTKLLLPRAASVRGRSIPGAAEKPKKEIPASPSRTKIPAEKESHRDVLPDKPAPGAVNVPAAGSHLGQ    211 - 280
GKRAIPVPNKLGLKKTLLKAPGSTSNLARKSSSGPVWSGASSACTSPAVGKAKSSEFASIPANSSRPLSN    281 - 350
ISKSGRMGPAMLRPALPAGPVGASSWQAKRVDVSELAAEQLTAPPSASPTQPQTPEGGGQWLNSSCAWSE    351 - 420
SSQLNKTRSIRRRDSCLNSKTKVMPTPTNQFKIPKFSIGDSPDSSTPKLSRAQRPQSCTSVGRVTVHSTP    421 - 490
VRRSSGPAPQSLLSAWRVSALPTPASRRCSGLPPMTPKTMPRAVGSPLCVPARRRSSEPRKNSAMRTEPT    491 - 560
RESNRKTDSRLVDVSPDRGSPPSRVPQALNFSPEESDSTFSKSTATEVAREEAKPGGDAAPSEALLVDIK    561 - 630
LEPLAVTPDAASQPLIDLPLIDFCDTPEAHVAVGSESRPLIDLMTNTPDMNKNVAKPSPVVGQLIDLSSP    631 - 700
LIQLSPEADKENVDSPLLKF                                                      701 - 720
//

Text Mined References (33)

PMID Year Title
26209226 2015 GTSE1 expression represses apoptotic signaling and confers cisplatin resistance in gastric cancer cells.
23236459 2012 GTSE1 is a microtubule plus-end tracking protein that regulates EB1-dependent cell migration.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22292647 2011 Up-regulation of GTSE1 lacks a relationship with clinical data in lung cancer.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20577264 2010 Polo-like kinase 1 phosphorylation of G2 and S-phase-expressed 1 protein is essential for p53 inactivation during G2 checkpoint recovery.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20018861 2010 Human GTSE-1 regulates p21(CIP1/WAF1) stability conferring resistance to paclitaxel treatment.
19946888 2010 Defining the membrane proteome of NK cells.
More...