Property Summary

NCBI Gene PubMed Count 29
PubMed Score 28.15
PubTator Score 12.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma 1.136 1.2e-02
adult high grade glioma 2.600 8.1e-06
Atopic dermatitis 2.000 5.9e-05
atypical teratoid / rhabdoid tumor 1.300 2.2e-05
Breast cancer 1.800 1.8e-10
ductal carcinoma in situ 1.900 2.1e-03
Endometriosis 1.229 1.9e-02
ependymoma 1.400 1.6e-06
esophageal adenocarcinoma 1.500 1.8e-02
glioblastoma 1.100 3.2e-05
group 3 medulloblastoma 1.900 5.3e-06
intraductal papillary-mucinous carcinoma... 1.900 8.5e-04
intraductal papillary-mucinous neoplasm ... 2.200 8.9e-05
invasive ductal carcinoma 1.800 1.1e-04
lung adenocarcinoma 1.200 1.4e-07
lung cancer 1.100 1.8e-03
malignant mesothelioma 1.300 2.1e-06
medulloblastoma, large-cell 2.000 3.4e-05
non-small cell lung cancer 1.315 3.9e-16
ovarian cancer -1.200 3.7e-04
pancreatic ductal adenocarcinoma liver m... 1.324 2.2e-02
primitive neuroectodermal tumor 1.900 1.6e-04
psoriasis 1.700 1.4e-102
ulcerative colitis 1.200 2.1e-06

Gene RIF (13)

AA Sequence

MDDPKKEDILLLADEKFDFDLSLSSSSANEDDEVFFGPFGHKERCIAASLELNNPVPEQPPLPTSESPFA      1 - 70
WSPLAGEKFVEVYKEAHLLALHIESSSRNQAAQAAKPEDPRSQGVERFIQESKLKINLFEKEKEMKKSPT     71 - 140
SLKRETYYLSDSPLLGPPVGEPRLLASSPALPSSGAQARLTRAPGPPHSAHALPRESCTAHAASQAATQR    141 - 210
KPGTKLLLPRAASVRGRSIPGAAEKPKKEIPASPSRTKIPAEKESHRDVLPDKPAPGAVNVPAAGSHLGQ    211 - 280
GKRAIPVPNKLGLKKTLLKAPGSTSNLARKSSSGPVWSGASSACTSPAVGKAKSSEFASIPANSSRPLSN    281 - 350
ISKSGRMGPAMLRPALPAGPVGASSWQAKRVDVSELAAEQLTAPPSASPTQPQTPEGGGQWLNSSCAWSE    351 - 420
SSQLNKTRSIRRRDSCLNSKTKVMPTPTNQFKIPKFSIGDSPDSSTPKLSRAQRPQSCTSVGRVTVHSTP    421 - 490
VRRSSGPAPQSLLSAWRVSALPTPASRRCSGLPPMTPKTMPRAVGSPLCVPARRRSSEPRKNSAMRTEPT    491 - 560
RESNRKTDSRLVDVSPDRGSPPSRVPQALNFSPEESDSTFSKSTATEVAREEAKPGGDAAPSEALLVDIK    561 - 630
LEPLAVTPDAASQPLIDLPLIDFCDTPEAHVAVGSESRPLIDLMTNTPDMNKNVAKPSPVVGQLIDLSSP    631 - 700
LIQLSPEADKENVDSPLLKF                                                      701 - 720
//

Text Mined References (36)

PMID Year Title