Property Summary

Ligand Count 24
NCBI Gene PubMed Count 64
PubMed Score 273.38
PubTator Score 110.28

Knowledge Summary

Patent (17,691)

Expression

  Differential Expression (26)

Disease log2 FC p
active ulcerative colitis 1.232 5.4e-03
adrenocortical carcinoma 1.053 1.9e-02
astrocytic glioma -2.800 1.2e-03
Astrocytoma, Pilocytic -1.700 9.8e-03
Breast cancer 2.900 2.6e-02
diabetes mellitus -1.400 1.2e-02
Duchenne muscular dystrophy 1.162 1.3e-07
ductal carcinoma in situ 1.300 4.5e-02
ependymoma -1.800 3.5e-02
fibroadenoma 1.300 4.9e-02
gastric cancer -2.200 4.3e-04
glioblastoma -1.200 2.0e-02
hepatocellular carcinoma -2.100 5.3e-06
intraductal papillary-mucinous adenoma (... -1.600 8.3e-03
lung cancer -1.900 1.2e-03
lung carcinoma -1.400 7.3e-06
nephrosclerosis 1.508 1.7e-04
oligodendroglioma -2.100 4.8e-02
osteosarcoma 1.187 3.9e-02
ovarian cancer -1.500 9.6e-03
pancreatic cancer -2.300 2.7e-04
pancreatic carcinoma -2.300 2.7e-04
pediatric high grade glioma -1.600 1.7e-02
psoriasis 1.100 4.0e-04
severe Alzheimer's disease -1.679 3.7e-02
spina bifida -2.058 4.2e-02

Gene RIF (48)

AA Sequence

MELLRTITYQPAASTKMCEQALGKGCGADSKKKRPPQPPEESQPPQSQAQVPPAAPHHHHHHSHSGPEIS      1 - 70
RIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQREKIDKEIELHRILHHK     71 - 140
HVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGN    141 - 210
FFINEAMELKVGDFGLAARLEPLEHRRRTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPF    211 - 280
ETTNLKETYRCIREARYTMPSSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHT    281 - 350
VPDFHLSSPAKNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEEL    351 - 420
QPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEAD    421 - 490
CIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKTVHYYAELGQCSVFPATD    491 - 560
APEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRLYLLQWLKSDKALMMLFNDGTFQVNFYHDHT    561 - 630
KIIICSQNEEYLLTYINEDRISTTFRLTTLLMSGCSSELKNRMEYALNMLLQRCN                   631 - 685
//

Text Mined References (69)

PMID Year Title