Property Summary

NCBI Gene PubMed Count 58
Grant Count 46
R01 Count 28
Funding $4,139,434.21
PubMed Score 250.35
PubTator Score 110.28

Knowledge Summary

Patent (17,691)

Expression

  Differential Expression (26)

Disease log2 FC p
nephrosclerosis 1.508 0.000
gastric cancer -2.200 0.000
hepatocellular carcinoma -2.100 0.000
pancreatic cancer -2.300 0.000
astrocytic glioma -2.800 0.001
ependymoma -1.800 0.035
oligodendroglioma -2.500 0.000
psoriasis 1.100 0.000
glioblastoma -2.300 0.003
osteosarcoma 1.187 0.039
Duchenne muscular dystrophy 1.162 0.000
adrenocortical carcinoma 1.053 0.019
intraductal papillary-mucinous adenoma (... -1.600 0.008
lung cancer -1.900 0.001
ulcerative colitis 1.700 0.000
fibroadenoma 1.300 0.049
diabetes mellitus -1.400 0.012
Breast cancer 2.900 0.026
pediatric high grade glioma -1.600 0.017
pilocytic astrocytoma -1.700 0.009
pancreatic carcinoma -2.300 0.000
severe Alzheimer's disease -1.679 0.037
lung carcinoma -1.400 0.000
spina bifida -2.058 0.042
ductal carcinoma in situ 1.300 0.045
ovarian cancer 3.200 0.000

Gene RIF (42)

PMID Text
26719332 Data suggest wild-type SNCA (alpha-synuclein) binding to synaptosome membrane is not affected by phosphorylation by PLK2; A30P SNCA, a Parkinson disease mutation, binding is greatly increased; endocytosis of SNCA fibrils follows similar pattern.
26625870 our study demonstrates a novel mechanism of PLK2 in promoting tumor progression, whereby it directly binds to enriched TAp73, catalyzes Ser48 phosphorylation of TAp73, and inhibits TAp73 transcriptional activity
26004360 these findings reveal a conserved PLK2-RAP1 pathway that is crucial to regulate endothelial tip cell behavior in order to ensure proper vascular development and patterning in vertebrates.
25846005 Structural analysis of the polo-box domain of human PLK2 has been presented.
25590559 PLK2 indirectly activates ROCK2 via phosphorylating nucleophosmin during centrosome amplification.
25511705 this study reports the first crystal structure of the C-terminal polo-box domain of PLK2.
25501818 Silencing of polo-like kinase 2 increases cell proliferation and decreases apoptosis in SGC-7901 gastric cancer cells.
25347426 Decreased PLK2 protein expression due to promoter hypermethylation was negatively correlated with JAK2 overexpression, a common occurrence in hematological malignancies.
25338102 Unique PLK2-dependent protein phosphorylation sites identified by mass spectrometry.
25239093 Data shows that PLK2 mRNA is a direct target of miR-27a in laryngeal squamous cell carcinoma.
More...

AA Sequence

MELLRTITYQPAASTKMCEQALGKGCGADSKKKRPPQPPEESQPPQSQAQVPPAAPHHHHHHSHSGPEIS      1 - 70
RIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQREKIDKEIELHRILHHK     71 - 140
HVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGN    141 - 210
FFINEAMELKVGDFGLAARLEPLEHRRRTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPF    211 - 280
ETTNLKETYRCIREARYTMPSSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHT    281 - 350
VPDFHLSSPAKNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEEL    351 - 420
QPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEAD    421 - 490
CIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKTVHYYAELGQCSVFPATD    491 - 560
APEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRLYLLQWLKSDKALMMLFNDGTFQVNFYHDHT    561 - 630
KIIICSQNEEYLLTYINEDRISTTFRLTTLLMSGCSSELKNRMEYALNMLLQRCN                   631 - 685
//

Text Mined References (63)

PMID Year Title
26719332 2016 Effects of Serine 129 Phosphorylation on ?-Synuclein Aggregation, Membrane Association, and Internalization.
26625870 2016 PLK2 phosphorylates and inhibits enriched TAp73 in human osteosarcoma cells.
26004360 2015 Polo-like kinase 2 regulates angiogenic sprouting and blood vessel development.
25846005 2015 Structural analysis of the polo-box domain of human Polo-like kinase 2.
25590559 2015 Functional relationship among PLK2, PLK4 and ROCK2 to induce centrosome amplification.
25511705 2015 Crystal structure of the polo-box domain of polo-like kinase 2.
25501818 2015 Silencing of polo-like kinase 2 increases cell proliferation and decreases apoptosis in SGC-7901 gastric cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25347426 2015 The deregulated promoter methylation of the Polo-like kinases as a potential biomarker in hematological malignancies.
25338102 2014 Identification of the PLK2-dependent phosphopeptidome by quantitative proteomics [corrected].
More...