Property Summary

NCBI Gene PubMed Count 58
PubMed Score 250.35
PubTator Score 110.28

Knowledge Summary

Patent (17,691)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
oligodendroglioma 2849 2.71489811754392E-16
Duchenne muscular dystrophy 602 1.34194524102195E-7
hepatocellular carcinoma 550 5.34431119267486E-6
lung carcinoma 2844 7.34885613987067E-6
ovarian cancer 8492 1.08124827196232E-5
ulcerative colitis 2087 1.18269540860548E-5
nephrosclerosis 329 1.67295058263479E-4
pancreatic cancer 2300 2.67466500964434E-4
pancreatic carcinoma 567 2.67466500964435E-4
psoriasis 6685 3.95076529785351E-4
gastric cancer 436 4.26929279770955E-4
astrocytic glioma 2241 0.00120510014400111
lung cancer 4473 0.00123056868982926
glioblastoma 5572 0.00320978711448162
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00832812703283932
pilocytic astrocytoma 3086 0.00946318938336366
diabetes mellitus 1663 0.0121647761036285
pediatric high grade glioma 2712 0.0171794311785422
adrenocortical carcinoma 1427 0.0187647797931346
Breast cancer 3099 0.0260219833290876
ependymoma 2514 0.0347786648467031
severe Alzheimer's disease 49 0.0365049465566842
osteosarcoma 7933 0.0386957672896153
spina bifida 1064 0.0421054453876914
ductal carcinoma in situ 1745 0.0445460608690978
fibroadenoma 557 0.0490016794859743
Disease Target Count Z-score Confidence
Kummell's disease 4 4.389 2.2
Cancer 2346 3.443 1.7
Parkinson's disease 364 3.086 1.5

Expression

  Differential Expression (26)

Disease log2 FC p
nephrosclerosis 1.508 0.000
gastric cancer -2.200 0.000
hepatocellular carcinoma -2.100 0.000
pancreatic cancer -2.300 0.000
astrocytic glioma -2.800 0.001
ependymoma -1.800 0.035
oligodendroglioma -2.500 0.000
psoriasis 1.100 0.000
glioblastoma -2.300 0.003
osteosarcoma 1.187 0.039
Duchenne muscular dystrophy 1.162 0.000
adrenocortical carcinoma 1.053 0.019
intraductal papillary-mucinous adenoma (... -1.600 0.008
lung cancer -1.900 0.001
ulcerative colitis 1.700 0.000
fibroadenoma 1.300 0.049
diabetes mellitus -1.400 0.012
Breast cancer 2.900 0.026
pediatric high grade glioma -1.600 0.017
pilocytic astrocytoma -1.700 0.009
pancreatic carcinoma -2.300 0.000
severe Alzheimer's disease -1.679 0.037
lung carcinoma -1.400 0.000
spina bifida -2.058 0.042
ductal carcinoma in situ 1.300 0.045
ovarian cancer 3.200 0.000

Synonym

Accession Q9NYY3 O60679 Q96CV7 Q9UE61
Symbols SNK
hSNK
hPlk2

Gene

PDB

4I5M   4I5P   4I6B   4I6F   4I6H   4RS6   4XB0  

  Ortholog (10)

Gene RIF (42)

PMID Text
26719332 Data suggest wild-type SNCA (alpha-synuclein) binding to synaptosome membrane is not affected by phosphorylation by PLK2; A30P SNCA, a Parkinson disease mutation, binding is greatly increased; endocytosis of SNCA fibrils follows similar pattern.
26625870 our study demonstrates a novel mechanism of PLK2 in promoting tumor progression, whereby it directly binds to enriched TAp73, catalyzes Ser48 phosphorylation of TAp73, and inhibits TAp73 transcriptional activity
26004360 these findings reveal a conserved PLK2-RAP1 pathway that is crucial to regulate endothelial tip cell behavior in order to ensure proper vascular development and patterning in vertebrates.
25846005 Structural analysis of the polo-box domain of human PLK2 has been presented.
25590559 PLK2 indirectly activates ROCK2 via phosphorylating nucleophosmin during centrosome amplification.
25511705 this study reports the first crystal structure of the C-terminal polo-box domain of PLK2.
25501818 Silencing of polo-like kinase 2 increases cell proliferation and decreases apoptosis in SGC-7901 gastric cancer cells.
25347426 Decreased PLK2 protein expression due to promoter hypermethylation was negatively correlated with JAK2 overexpression, a common occurrence in hematological malignancies.
25338102 Unique PLK2-dependent protein phosphorylation sites identified by mass spectrometry.
25239093 Data shows that PLK2 mRNA is a direct target of miR-27a in laryngeal squamous cell carcinoma.
More...

AA Sequence

MELLRTITYQPAASTKMCEQALGKGCGADSKKKRPPQPPEESQPPQSQAQVPPAAPHHHHHHSHSGPEIS      1 - 70
RIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQREKIDKEIELHRILHHK     71 - 140
HVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGN    141 - 210
FFINEAMELKVGDFGLAARLEPLEHRRRTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPF    211 - 280
ETTNLKETYRCIREARYTMPSSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHT    281 - 350
VPDFHLSSPAKNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEEL    351 - 420
QPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEAD    421 - 490
CIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKTVHYYAELGQCSVFPATD    491 - 560
APEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRLYLLQWLKSDKALMMLFNDGTFQVNFYHDHT    561 - 630
KIIICSQNEEYLLTYINEDRISTTFRLTTLLMSGCSSELKNRMEYALNMLLQRCN                   631 - 685
//

Text Mined References (63)

PMID Year Title
26719332 2016 Effects of Serine 129 Phosphorylation on ?-Synuclein Aggregation, Membrane Association, and Internalization.
26625870 2016 PLK2 phosphorylates and inhibits enriched TAp73 in human osteosarcoma cells.
26004360 2015 Polo-like kinase 2 regulates angiogenic sprouting and blood vessel development.
25846005 2015 Structural analysis of the polo-box domain of human Polo-like kinase 2.
25590559 2015 Functional relationship among PLK2, PLK4 and ROCK2 to induce centrosome amplification.
25511705 2015 Crystal structure of the polo-box domain of polo-like kinase 2.
25501818 2015 Silencing of polo-like kinase 2 increases cell proliferation and decreases apoptosis in SGC-7901 gastric cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25347426 2015 The deregulated promoter methylation of the Polo-like kinases as a potential biomarker in hematological malignancies.
25338102 2014 Identification of the PLK2-dependent phosphopeptidome by quantitative proteomics [corrected].
More...