Property Summary

NCBI Gene PubMed Count 61
Grant Count 24
R01 Count 13
Funding $3,236,365.71
PubMed Score 0.07
PubTator Score 70.25

Knowledge Summary

Patent

No data available

Gene RIF (56)

PMID Text
26404542 Data show reduced cytokines IL-10 and IL-19 expression, and enhanced IL-20 and il-1 beta expression in chronic recurrent multifocal osteomyelitis (CRMO) monocytes.
26354610 Coincident diabetes mellitus type 2 in either pulmonary or latent tuberculosis is characterized by decreased production of the IL-20 subfamily of cytokines.
25631632 IL-20 serum levels were increased in patients with active multiple myeloma compared to both healthy controls and responders to bortezomib-based treatment.IL-20 participate actively in the pathophysiology of multiple myeloma progression.
25543042 IL-20 may play a patho-physiologic role in the Th2 immune response in human asthma and may be a potential biomarker of asthma severity.
25178435 Distribution of interleukin-10 family cytokines in serum and synovial fluid of patients with inflammatory arthritis reveals different
25028099 Overexpression of IL-20 was detected in the airway epithelium collected from patients with asthma.
24628979 IL-20 is produced by keratinocytes, released into the epidermis and then possibly taken up by papillary mononuclear cells
24470401 Decreased interleukin-20 expression in scleroderma skin contributes to cutaneous fibrosis.
23892591 This study demonstrates that rs1713239 and infection may have potential synergetic effect on modulating the transcriptional activity of IL-20.
23812620 We observed that IL-20 which is an IL-10 group angiogenesis indicator was suppressed in systemic sclerosis, suggesting abnormal angiogenesis.
More...

AA Sequence

MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTES      1 - 70
LQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMK     71 - 140
KYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE                                      141 - 176
//

Text Mined References (63)

PMID Year Title
26404542 2015 Altered expression of IL-10 family cytokines in monocytes from CRMO patients result in enhanced IL-1? expression and release.
26354610 2015 Type 2 diabetes - Tuberculosis co-morbidity is associated with diminished circulating levels of IL-20 subfamily of cytokines.
25631632 2015 Circulating serum levels of IL-20 in multiple myeloma patients: its significance in angiogenesis and disease activity.
25543042 2014 The correlation between IL-20 and the Th2 immune response in human asthma.
25178435 2015 Distribution of interleukin-10 family cytokines in serum and synovial fluid of patients with inflammatory arthritis reveals different contribution to systemic and joint inflammation.
25028099 2014 Interleukin-20 promotes airway remodeling in asthma.
24628979 2014 Interleukin 20 protein locates to distinct mononuclear cells in psoriatic skin.
24470401 2014 Decreased interleukin-20 expression in scleroderma skin contributes to cutaneous fibrosis.
23892591 2014 Potential synergy between SNP and CpG-A or IL-1? in regulating transcriptional activity of IL-20 promoter.
23812620 2013 Decreased interleukin-20 level in patients with systemic sclerosis: are they related with angiogenesis?
More...