Property Summary

NCBI Gene PubMed Count 61
PubMed Score 0.07
PubTator Score 70.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 3.52395315846338E-149
ovarian cancer 8492 2.33697098123145E-4
medulloblastoma, large-cell 6234 0.00223720471636261
Breast cancer 3099 0.00267991375785484

Synonym

Accession Q9NYY1 Q17RB3 Q2THG6 Q96QZ6 IL-20
Symbols IL-20
IL10D
ZCYTO10

Gene

PDB

4DOH  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG

Gene RIF (56)

PMID Text
26404542 Data show reduced cytokines IL-10 and IL-19 expression, and enhanced IL-20 and il-1 beta expression in chronic recurrent multifocal osteomyelitis (CRMO) monocytes.
26354610 Coincident diabetes mellitus type 2 in either pulmonary or latent tuberculosis is characterized by decreased production of the IL-20 subfamily of cytokines.
25631632 IL-20 serum levels were increased in patients with active multiple myeloma compared to both healthy controls and responders to bortezomib-based treatment.IL-20 participate actively in the pathophysiology of multiple myeloma progression.
25543042 IL-20 may play a patho-physiologic role in the Th2 immune response in human asthma and may be a potential biomarker of asthma severity.
25178435 Distribution of interleukin-10 family cytokines in serum and synovial fluid of patients with inflammatory arthritis reveals different
25028099 Overexpression of IL-20 was detected in the airway epithelium collected from patients with asthma.
24628979 IL-20 is produced by keratinocytes, released into the epidermis and then possibly taken up by papillary mononuclear cells
24470401 Decreased interleukin-20 expression in scleroderma skin contributes to cutaneous fibrosis.
23892591 This study demonstrates that rs1713239 and infection may have potential synergetic effect on modulating the transcriptional activity of IL-20.
23812620 We observed that IL-20 which is an IL-10 group angiogenesis indicator was suppressed in systemic sclerosis, suggesting abnormal angiogenesis.
More...

AA Sequence

MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTES      1 - 70
LQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMK     71 - 140
KYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE                                      141 - 176
//

Text Mined References (63)

PMID Year Title
26404542 2015 Altered expression of IL-10 family cytokines in monocytes from CRMO patients result in enhanced IL-1? expression and release.
26354610 2015 Type 2 diabetes - Tuberculosis co-morbidity is associated with diminished circulating levels of IL-20 subfamily of cytokines.
25631632 2015 Circulating serum levels of IL-20 in multiple myeloma patients: its significance in angiogenesis and disease activity.
25543042 2014 The correlation between IL-20 and the Th2 immune response in human asthma.
25178435 2015 Distribution of interleukin-10 family cytokines in serum and synovial fluid of patients with inflammatory arthritis reveals different contribution to systemic and joint inflammation.
25028099 2014 Interleukin-20 promotes airway remodeling in asthma.
24628979 2014 Interleukin 20 protein locates to distinct mononuclear cells in psoriatic skin.
24470401 2014 Decreased interleukin-20 expression in scleroderma skin contributes to cutaneous fibrosis.
23892591 2014 Potential synergy between SNP and CpG-A or IL-1? in regulating transcriptional activity of IL-20 promoter.
23812620 2013 Decreased interleukin-20 level in patients with systemic sclerosis: are they related with angiogenesis?
More...