Property Summary

NCBI Gene PubMed Count 17
PubMed Score 22.29
PubTator Score 15.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -2.700 0.000
posterior fossa group A ependymoma -2.600 0.000
glioblastoma -3.500 0.000
oligodendroglioma -2.900 0.000
sonic hedgehog group medulloblastoma -4.400 0.000
atypical teratoid/rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -3.900 0.000
primitive neuroectodermal tumor -1.900 0.002
adult high grade glioma -3.800 0.000
pilocytic astrocytoma -4.000 0.000
Pick disease -2.100 0.015
pituitary cancer 1.700 0.000

Synonym

Accession Q9NYX4 Q5VWX3 Q5VWY5 Q5VWY6
Symbols NSG3
DRD1IP

Gene

 GO Function (1)

Gene RIF (14)

PMID Text
25376768 This review focuses on two closely related, neuron-enriched endosomal proteins: NEEP21 and Calcyon which perform distinct roles in regulating receptor endocytosis, recycling, and degradation--{REVIEW}
22843680 Calcyon forms a novel ternary complex with dopamine D1 receptor through PSD-95 protein and plays a role in dopamine receptor internalization
21415033 Association of the calcyon neuron-specific vesicular protein gene (CALY) with adolescent smoking initiation.
20602615 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
19352218 Observational study of gene-disease association. (HuGE Navigator)
17885599 mobility and storage properties of calcyon-containing vesicles imply that they play a role in brain plasticity
16595675 Using the calcyon cytosolic domain as bait, we isolated clathrin light chain in a yeast two-hybrid screen. The interaction domain was mapped to the heavy chain binding domain and C-terminal regions of light chain.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16172615 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQ      1 - 70
RLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPER     71 - 140
HRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGS    141 - 210
AAPPPAQ                                                                   211 - 217
//

Text Mined References (23)

PMID Year Title
25376768 2015 Complementary roles of the neuron-enriched endosomal proteins NEEP21 and calcyon in neuronal vesicle trafficking.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
22843680 2012 Calcyon forms a novel ternary complex with dopamine D1 receptor through PSD-95 protein and plays a role in dopamine receptor internalization.
21415033 2011 Association of the calcyon neuron-specific vesicular protein gene (CALY) with adolescent smoking initiation in China and California.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19352218 2009 Candidate gene analysis in an on-going genome-wide association study of attention-deficit hyperactivity disorder: suggestive association signals in ADRA1A.
17885599 2007 Intracellular dynamics of calcyon, a neuron-specific vesicular protein.
17623072 2007 Calcyon mRNA expression in the frontal-striatal circuitry and its relationship to vesicular processes and ADHD.
More...