Property Summary

NCBI Gene PubMed Count 17
PubMed Score 23.11
PubTator Score 15.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.400 1.5e-05
astrocytic glioma -2.600 1.8e-03
Astrocytoma, Pilocytic -3.900 3.1e-15
atypical teratoid / rhabdoid tumor -1.400 3.1e-10
ependymoma -2.400 2.7e-02
glioblastoma -3.500 1.5e-11
group 3 medulloblastoma -3.800 1.7e-06
medulloblastoma, large-cell -1.300 7.6e-05
oligodendroglioma -2.900 2.5e-20
Pick disease -2.100 1.5e-02
pituitary cancer 1.700 7.7e-06
primitive neuroectodermal tumor -1.200 1.0e-06

Gene RIF (14)

AA Sequence

MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQ      1 - 70
RLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPER     71 - 140
HRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGS    141 - 210
AAPPPAQ                                                                   211 - 217
//

Text Mined References (23)

PMID Year Title