Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.07
PubTator Score 6.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
group 4 medulloblastoma 1855 6.3e-06
ovarian cancer 8520 1.0e-03
medulloblastoma, large-cell 6241 1.1e-03
osteosarcoma 7950 2.6e-03
ependymoma 4679 6.9e-03
Breast cancer 3578 4.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Hyperaldosteronism 35 3.297 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 3.000 4.3e-02
ependymoma 1.100 6.9e-03
group 4 medulloblastoma 1.700 6.3e-06
medulloblastoma, large-cell 1.100 1.1e-03
osteosarcoma 1.597 2.6e-03
ovarian cancer -1.200 1.0e-03

Gene RIF (6)

AA Sequence

MNTLQGPVSFKDVAVDFTQEEWQQLDPDEKITYRDVMLENYSHLVSVGYDTTKPNVIIKLEQGEEPWIMG      1 - 70
GEFPCQHSPEAWRVDDLIERIQENEDKHSRQAACINSKTLTEEKENTFSQIYMETSLVPSSIIAHNCVSC     71 - 140
GKNLESISQLISSDGSYARTKPDECNECGKTYHGEKMCEFNQNGDTYSHNEENILQKISILEKPFEYNEC    141 - 210
MEALDNEAVFIAHKRAYIGEKPYEWNDSGPDFIQMSNFNAYQRSQMEMKPFECSECGKSFCKKSKFIIHQ    211 - 280
RAHTGEKPYECNVCGKSFSQKGTLTVHRRSHLEEKPYKCNECGKTFCQKLHLTQHLRTHSGEKPYECSEC    281 - 350
GKTFCQKTHLTLHQRNHSGERPYPCNECGKSFSRKSALSDHQRTHTGEKLYKCNECGKSYYRKSTLITHQ    351 - 420
RTHTGEKPYQCSECGKFFSRVSYLTIHYRSHLEEKPYECNECGKTFNLNSAFIRHRKVHTEEKSHECSEC    421 - 490
GKFSQLYLTDHHTAHLEEKPYECNECGKTFLVNSAFDGHQPLPKGEKSYECNVCGKLFNELSYYTEHYRS    491 - 560
HSEEKPYGCSECGKTFSHNSSLFRHQRVHTGEKPYECYECGKFFSQKSYLTIHHRIHSGEKPYECSKCGK    561 - 630
VFSRMSNLTVHYRSHSGEKPYECNECGKVFSQKSYLTVHYRTHSGEKPYECNECGKKFHHRSAFNSHQRI    631 - 700
HRRGNMNVLDVENL                                                            701 - 714
//

Text Mined References (17)

PMID Year Title