Property Summary

NCBI Gene PubMed Count 21
PubMed Score 9.94
PubTator Score 9.59

Knowledge Summary

Patent (3,055)

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Rectal neoplasm 7 3.73 1.9
Autistic Disorder 320 2.0

Gene RIF (7)

PMID Text
26684251 TAS2R agonists block signaling downstream of phosphatidylinositol 3-kinase
25573083 Expression and functional activity of the bitter taste receptors TAS2R1 and TAS2R38 in human keratinocytes
22683571 Intracellular signaling and cell mechanics using isolated human airway smooth muscle, mouse tracheal responses, and human bronchial responses to characterize TAS2R relaxation in the context of beta(2)AR desensitization.
21852241 Structural basis of activation of bitter taste receptor T2R1 and comparison with Class A G-protein-coupled receptors (GPCRs).
21619450 The formation of a short helical segment in intracellular loop II may be necessary for the activation of hTAS2R1.
20599705 The ligand binding pocket in T2R1 is present on the extracellular surface of the receptor, and is formed by the transmembrane helices 1, 2, 3 and 7 and with extracellular loops 1 and 2 forming a cap like structure on the binding pocket.
19812673 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MLESHLIIYFLLAVIQFLLGIFTNGIIVVVNGIDLIKHRKMAPLDLLLSCLAVSRIFLQLFIFYVNVIVI      1 - 70
FFIEFIMCSANCAILLFINELELWLATWLGVFYCAKVASVRHPLFIWLKMRISKLVPWMILGSLLYVSMI     71 - 140
CVFHSKYAGFMVPYFLRKFFSQNATIQKEDTLAIQIFSFVAEFSVPLLIFLFAVLLLIFSLGRHTRQMRN    141 - 210
TVAGSRVPGRGAPISALLSILSFLILYFSHCMIKVFLSSLKFHIRRFIFLFFILVIGIYPSGHSLILILG    211 - 280
NPKLKQNAKKFLLHSKCCQ                                                       281 - 299
//

Text Mined References (21)

PMID Year Title
26684251 2016 Antimitogenic effect of bitter taste receptor agonists on airway smooth muscle cells.
25573083 2015 Expression and functional activity of the bitter taste receptors TAS2R1 and TAS2R38 in human keratinocytes.
23646285 2013 Genome-wide association study of HLA-DQB1*06:02 negative essential hypersomnia.
22683571 2012 TAS2R activation promotes airway smooth muscle relaxation despite ?(2)-adrenergic receptor tachyphylaxis.
21852241 2011 Structural basis of activation of bitter taste receptor T2R1 and comparison with Class A G-protein-coupled receptors (GPCRs).
21619450 2011 Structure-function relationships of the human bitter taste receptor hTAS2R1: insights from molecular modeling studies.
20599705 2010 Bitter taste receptor T2R1 is activated by dipeptides and tripeptides.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
19812673 2009 A genome-wide linkage and association scan reveals novel loci for autism.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
More...