Property Summary

NCBI Gene PubMed Count 21
PubMed Score 10.30
PubTator Score 9.59

Knowledge Summary

Patent (3,055)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
lung cancer 4740 0.0 0.5
Disease Target Count Z-score Confidence
Autistic Disorder 364 0.0 2.2
Disease Target Count Z-score Confidence
Rectal neoplasm 6 3.68 1.8

Gene RIF (7)

AA Sequence

MLESHLIIYFLLAVIQFLLGIFTNGIIVVVNGIDLIKHRKMAPLDLLLSCLAVSRIFLQLFIFYVNVIVI      1 - 70
FFIEFIMCSANCAILLFINELELWLATWLGVFYCAKVASVRHPLFIWLKMRISKLVPWMILGSLLYVSMI     71 - 140
CVFHSKYAGFMVPYFLRKFFSQNATIQKEDTLAIQIFSFVAEFSVPLLIFLFAVLLLIFSLGRHTRQMRN    141 - 210
TVAGSRVPGRGAPISALLSILSFLILYFSHCMIKVFLSSLKFHIRRFIFLFFILVIGIYPSGHSLILILG    211 - 280
NPKLKQNAKKFLLHSKCCQ                                                       281 - 299
//

Text Mined References (21)

PMID Year Title