Property Summary

NCBI Gene PubMed Count 20
PubMed Score 3.37
PubTator Score 2.25

Knowledge Summary

Patent (1,924)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.100 1.1e-03

Gene RIF (3)

AA Sequence

MMGLTEGVFLILSGTQFTLGILVNCFIELVNGSSWFKTKRMSLSDFIITTLALLRIILLCIILTDSFLIE      1 - 70
FSPNTHDSGIIMQIIDVSWTFTNHLSIWLATCLGVLYCLKIASFSHPTFLWLKWRVSRVMVWMLLGALLL     71 - 140
SCGSTASLINEFKLYSVFRGIEATRNVTEHFRKKRSEYYLIHVLGTLWYLPPLIVSLASYSLLIFSLGRH    141 - 210
TRQMLQNGTSSRDPTTEAHKRAIRIILSFFFLFLLYFLAFLIASFGNFLPKTKMAKMIGEVMTMFYPAGH    211 - 280
SFILILGNSKLKQTFVVMLRCESGHLKPGSKGPIFS                                      281 - 316
//

Text Mined References (20)

PMID Year Title