Tbio | Taste receptor type 2 member 3 |
Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5.
This gene encodes a member of a family of candidate taste receptors that are members of the G protein-coupled receptor superfamily and that are specifically expressed by taste receptor cells of the tongue and palate epithelia. These apparently intronless taste receptor genes encode a 7-transmembrane receptor protein, functioning as a bitter taste receptor. This gene is clustered with another 3 candidate taste receptor genes in chromosome 7 and is genetically linked to loci that influence bitter perception. [provided by RefSeq, Jul 2008]
This gene encodes a member of a family of candidate taste receptors that are members of the G protein-coupled receptor superfamily and that are specifically expressed by taste receptor cells of the tongue and palate epithelia. These apparently intronless taste receptor genes encode a 7-transmembrane receptor protein, functioning as a bitter taste receptor. This gene is clustered with another 3 candidate taste receptor genes in chromosome 7 and is genetically linked to loci that influence bitter perception. [provided by RefSeq, Jul 2008]
Comments
Species | Source |
---|---|
Chimp | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Opossum | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG |
MMGLTEGVFLILSGTQFTLGILVNCFIELVNGSSWFKTKRMSLSDFIITTLALLRIILLCIILTDSFLIE 1 - 70 FSPNTHDSGIIMQIIDVSWTFTNHLSIWLATCLGVLYCLKIASFSHPTFLWLKWRVSRVMVWMLLGALLL 71 - 140 SCGSTASLINEFKLYSVFRGIEATRNVTEHFRKKRSEYYLIHVLGTLWYLPPLIVSLASYSLLIFSLGRH 141 - 210 TRQMLQNGTSSRDPTTEAHKRAIRIILSFFFLFLLYFLAFLIASFGNFLPKTKMAKMIGEVMTMFYPAGH 211 - 280 SFILILGNSKLKQTFVVMLRCESGHLKPGSKGPIFS 281 - 316 //
PMID | Year | Title |
---|---|---|
23568457 | 2013 | Genetic variants associated with disordered eating. |
22397221 | 2012 | Patients with phantogeusia show increased expression of T2R taste receptor genes in their tongues. |
20022913 | 2010 | The molecular receptive ranges of human TAS2R bitter taste receptors. |
19372376 | 2009 | Upstream open reading frames cause widespread reduction of protein expression and are polymorphic among humans. |
15744053 | 2005 | Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates. |
15496549 | 2005 | Evolution of bitter taste receptors in humans and apes. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
12853948 | 2003 | The DNA sequence of human chromosome 7. |
12690205 | 2003 | Human chromosome 7: DNA sequence and biology. |
12581520 | 2003 | Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways. |
More... |