Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.61
PubTator Score 14.90

Knowledge Summary

Patent (4,883)

TINX Plot

  Disease (2)

Disease Target Count P-value
non diabetic and post-ischemic heart failure 200 2.7e-03
lung cancer 4740 9.0e-03
Disease Target Count Z-score Confidence
Common cold 67 3.313 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.800 9.0e-03
non diabetic and post-ischemic heart fai... 1.100 2.7e-03

Gene RIF (7)

AA Sequence

MLRLFYFSAIIASVILNFVGIIMNLFITVVNCKTWVKSHRISSSDRILFSLGITRFLMLGLFLVNTIYFV      1 - 70
SSNTERSVYLSAFFVLCFMFLDSSSVWFVTLLNILYCVKITNFQHSVFLLLKRNISPKIPRLLLACVLIS     71 - 140
AFTTCLYITLSQASPFPELVTTRNNTSFNISEGILSLVVSLVLSSSLQFIINVTSASLLIHSLRRHIQKM    141 - 210
QKNATGFWNPQTEAHVGAMKLMVYFLILYIPYSVATLVQYLPFYAGMDMGTKSICLIFATLYSPGHSVLI    211 - 280
IITHPKLKTTAKKILCFKK                                                       281 - 299
//

Text Mined References (23)

PMID Year Title