Property Summary

NCBI Gene PubMed Count 20
PubMed Score 16.36
PubTator Score 14.90

Knowledge Summary

Patent (4,883)

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
non diabetic and post-ischemic heart fai... 1.100 0.003
lung cancer 1.800 0.009

Synonym

Accession Q9NYW5 Q645W5 Q75MV8 T2R4
Symbols T2R4

Gene

Gene RIF (5)

PMID Text
25858111 Data indicate that KLK/R motif in C-terminus performs functional role in bitter taste receptor T2R4 signaling.
25844797 The antagonist ability of ABA was tested using another T2R4 agonist, yohimbine. Our results suggest that ABA does not inhibit yohimbine-induced T2R4 activity.
25059668 Data indicate that the itter blockers and agonists share the same orthosteric site in bitter taste receptor T2R4.
23159609 these results show that rhodopsin N-terminal 33 amino acids enhance expression of T2R4 by 2.5-fold and do not cause perturbations in the receptor structure.
22794107 This study demonistrated that human TAS2R4 play the role of food preference behavior.

AA Sequence

MLRLFYFSAIIASVILNFVGIIMNLFITVVNCKTWVKSHRISSSDRILFSLGITRFLMLGLFLVNTIYFV      1 - 70
SSNTERSVYLSAFFVLCFMFLDSSSVWFVTLLNILYCVKITNFQHSVFLLLKRNISPKIPRLLLACVLIS     71 - 140
AFTTCLYITLSQASPFPELVTTRNNTSFNISEGILSLVVSLVLSSSLQFIINVTSASLLIHSLRRHIQKM    141 - 210
QKNATGFWNPQTEAHVGAMKLMVYFLILYIPYSVATLVQYLPFYAGMDMGTKSICLIFATLYSPGHSVLI    211 - 280
IITHPKLKTTAKKILCFKK                                                       281 - 299
//

Text Mined References (21)

PMID Year Title
25858111 2015 The structure-function role of C-terminus in human bitter taste receptor T2R4 signaling.
25844797 2015 Abscisic Acid Acts as a Blocker of the Bitter Taste G Protein-Coupled Receptor T2R4.
25059668 2014 Amino acid derivatives as bitter taste receptor (T2R) blockers.
23568457 2013 Genetic variants associated with disordered eating.
23159609 2013 Role of rhodopsin N-terminus in structure and function of rhodopsin-bitter taste receptor chimeras.
22794107 2012 Behavioral analysis of Drosophila transformants expressing human taste receptor genes in the gustatory receptor neurons.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
19628819 2009 Motile cilia of human airway epithelia are chemosensory.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
More...