Property Summary

NCBI Gene PubMed Count 19
Grant Count 2
Funding $91,996.2
PubMed Score 4.40
PubTator Score 4.60

Knowledge Summary

Patent (1,681)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Stomatitis 19 3.159 1.6

Expression

Synonym

Accession Q9NYW4 Q645W0 Q75MV7 T2R5
Symbols T2R5

Gene

 Grant Application (2)

AA Sequence

MLSAGLGLLMLVAVVEFLIGLIGNGSLVVWSFREWIRKFNWSSYNLIILGLAGCRFLLQWLIILDLSLFP      1 - 70
LFQSSRWLRYLSIFWVLVSQASLWFATFLSVFYCKKITTFDRPAYLWLKQRAYNLSLWCLLGYFIINLLL     71 - 140
TVQIGLTFYHPPQGNSSIRYPFESWQYLYAFQLNSGSYLPLVVFLVSSGMLIVSLYTHHKKMKVHSAGRR    141 - 210
DVRAKAHITALKSLGCFLLLHLVYIMASPFSITSKTYPPDLTSVFIWETLMAAYPSLHSLILIMGIPRVK    211 - 280
QTCQKILWKTVCARRCWGP                                                       281 - 299
//

Text Mined References (19)

PMID Year Title
23568457 2013 Genetic variants associated with disordered eating.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17108952 2006 The receptors and cells for mammalian taste.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
More...