Property Summary

NCBI Gene PubMed Count 19
PubMed Score 4.98
PubTator Score 4.60

Knowledge Summary

Patent (1,681)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Stomatitis 21 3.196 1.6

Expression

AA Sequence

MLSAGLGLLMLVAVVEFLIGLIGNGSLVVWSFREWIRKFNWSSYNLIILGLAGCRFLLQWLIILDLSLFP      1 - 70
LFQSSRWLRYLSIFWVLVSQASLWFATFLSVFYCKKITTFDRPAYLWLKQRAYNLSLWCLLGYFIINLLL     71 - 140
TVQIGLTFYHPPQGNSSIRYPFESWQYLYAFQLNSGSYLPLVVFLVSSGMLIVSLYTHHKKMKVHSAGRR    141 - 210
DVRAKAHITALKSLGCFLLLHLVYIMASPFSITSKTYPPDLTSVFIWETLMAAYPSLHSLILIMGIPRVK    211 - 280
QTCQKILWKTVCARRCWGP                                                       281 - 299
//

Text Mined References (19)

PMID Year Title