Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.18
PubTator Score 2.78

Knowledge Summary

Patent (3,333)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Gene RIF (2)

AA Sequence

MFSPADNIFIILITGEFILGILGNGYIALVNWIDWIKKKKISTVDYILTNLVIARICLISVMVVNGIVIV      1 - 70
LNPDVYTKNKQQIVIFTFWTFANYLNMWITTCLNVFYFLKIASSSHPLFLWLKWKIDMVVHWILLGCFAI     71 - 140
SLLVSLIAAIVLSCDYRFHAIAKHKRNITEMFHVSKIPYFEPLTLFNLFAIVPFIVSLISFFLLVRSLWR    141 - 210
HTKQIKLYATGSRDPSTEVHVRAIKTMTSFIFFFFLYYISSILMTFSYLMTKYKLAVEFGEIAAILYPLG    211 - 280
HSLILIVLNNKLRQTFVRMLTCRKIACMI                                             281 - 309
//

Text Mined References (15)

PMID Year Title