Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.91
PubTator Score 2.78

Knowledge Summary

Patent (3,333)

Gene RIF (1)

PMID Text
21670512 Human bitter taste receptors hTAS2R8 and hTAS2R39 display differential functions to recognize bitter peptides.

AA Sequence

MFSPADNIFIILITGEFILGILGNGYIALVNWIDWIKKKKISTVDYILTNLVIARICLISVMVVNGIVIV      1 - 70
LNPDVYTKNKQQIVIFTFWTFANYLNMWITTCLNVFYFLKIASSSHPLFLWLKWKIDMVVHWILLGCFAI     71 - 140
SLLVSLIAAIVLSCDYRFHAIAKHKRNITEMFHVSKIPYFEPLTLFNLFAIVPFIVSLISFFLLVRSLWR    141 - 210
HTKQIKLYATGSRDPSTEVHVRAIKTMTSFIFFFFLYYISSILMTFSYLMTKYKLAVEFGEIAAILYPLG    211 - 280
HSLILIVLNNKLRQTFVRMLTCRKIACMI                                             281 - 309
//

Text Mined References (14)

PMID Year Title
21670512 2011 Human bitter taste receptors hTAS2R8 and hTAS2R39 with differential functions to recognize bitter peptides.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12139982 2002 Receptors for bitter and sweet taste.
11696554 2002 Molecular mechanisms of bitter and sweet taste transduction.
More...