Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.64
PubTator Score 1.70

Knowledge Summary

Patent (3,161)

Gene RIF (1)

PMID Text
19092995 A functionally compromised TAS2R receptor negatively impacts glucose homeostasis, providing an important link between alimentary chemosensation and metabolic disease.

AA Sequence

MPSAIEAIYIILIAGELTIGIWGNGFIVLVNCIDWLKRRDISLIDIILISLAISRICLLCVISLDGFFML      1 - 70
LFPGTYGNSVLVSIVNVVWTFANNSSLWFTSCLSIFYLLKIANISHPFFFWLKLKINKVMLAILLGSFLI     71 - 140
SLIISVPKNDDMWYHLFKVSHEENITWKFKVSKIPGTFKQLTLNLGVMVPFILCLISFFLLLFSLVRHTK    141 - 210
QIRLHATGFRDPSTEAHMRAIKAVIIFLLLLIVYYPVFLVMTSSALIPQGKLVLMIGDIVTVIFPSSHSF    211 - 280
ILIMGNSKLREAFLKMLRFVKCFLRRRKPFVP                                          281 - 312
//

Text Mined References (12)

PMID Year Title
19092995 2008 Bitter taste receptors influence glucose homeostasis.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12139982 2002 Receptors for bitter and sweet taste.
11696554 2002 Molecular mechanisms of bitter and sweet taste transduction.
10774719 2000 A plethora of taste receptors.
10766242 2000 A family of candidate taste receptors in human and mouse.
More...