Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.80
PubTator Score 1.70

Knowledge Summary

Patent (3,161)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Gene RIF (1)

AA Sequence

MPSAIEAIYIILIAGELTIGIWGNGFIVLVNCIDWLKRRDISLIDIILISLAISRICLLCVISLDGFFML      1 - 70
LFPGTYGNSVLVSIVNVVWTFANNSSLWFTSCLSIFYLLKIANISHPFFFWLKLKINKVMLAILLGSFLI     71 - 140
SLIISVPKNDDMWYHLFKVSHEENITWKFKVSKIPGTFKQLTLNLGVMVPFILCLISFFLLLFSLVRHTK    141 - 210
QIRLHATGFRDPSTEAHMRAIKAVIIFLLLLIVYYPVFLVMTSSALIPQGKLVLMIGDIVTVIFPSSHSF    211 - 280
ILIMGNSKLREAFLKMLRFVKCFLRRRKPFVP                                          281 - 312
//

Text Mined References (12)

PMID Year Title