Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.56
PubTator Score 8.21

Knowledge Summary

Patent (3,770)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.8e-03
medulloblastoma, large-cell 6241 2.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 2.1e-03
osteosarcoma 1.244 1.8e-03

Gene RIF (2)

AA Sequence

MLRVVEGIFIFVVVSESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWIIITDGFIQIF      1 - 70
SPNIYASGNLIEYISYFWVIGNQSSMWFATSLSIFYFLKIANFSNYIFLWLKSRTNMVLPFMIVFLLISS     71 - 140
LLNFAYIAKILNDYKTKNDTVWDLNMYKSEYFIKQILLNLGVIFFFTLSLITCIFLIISLWRHNRQMQSN    141 - 210
VTGLRDSNTEAHVKAMKVLISFIILFILYFIGMAIEISCFTVRENKLLLMFGMTTTAIYPWGHSFILILG    211 - 280
NSKLKQASLRVLQQLKCCEKRKNLRVT                                               281 - 307
//

Text Mined References (16)

PMID Year Title