Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.76
PubTator Score 8.21

Knowledge Summary

Patent (3,770)

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.244 0.002
medulloblastoma, large-cell 1.200 0.002

Gene RIF (1)

PMID Text
23283334 The human bitter taste receptor TAS2R10 is tailored to accommodate numerous diverse ligands

AA Sequence

MLRVVEGIFIFVVVSESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWIIITDGFIQIF      1 - 70
SPNIYASGNLIEYISYFWVIGNQSSMWFATSLSIFYFLKIANFSNYIFLWLKSRTNMVLPFMIVFLLISS     71 - 140
LLNFAYIAKILNDYKTKNDTVWDLNMYKSEYFIKQILLNLGVIFFFTLSLITCIFLIISLWRHNRQMQSN    141 - 210
VTGLRDSNTEAHVKAMKVLISFIILFILYFIGMAIEISCFTVRENKLLLMFGMTTTAIYPWGHSFILILG    211 - 280
NSKLKQASLRVLQQLKCCEKRKNLRVT                                               281 - 307
//

Text Mined References (15)

PMID Year Title
23283334 2013 The human bitter taste receptor TAS2R10 is tailored to accommodate numerous diverse ligands.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
16541075 2006 The finished DNA sequence of human chromosome 12.
15759003 2005 The receptors and coding logic for bitter taste.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12139982 2002 Receptors for bitter and sweet taste.
More...