Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.55
PubTator Score 5.96

Knowledge Summary

Patent (7,737)

TINX Plot

  Disease (3)

Disease Target Count
alcohol use disorder 12
Disease Target Count P-value
lung cancer 4740 6.9e-03
Disease Target Count Z-score Confidence
Pelvic inflammatory disease 21 3.655 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.300 6.9e-03

Gene RIF (2)

AA Sequence

MESALPSIFTLVIIAEFIIGNLSNGFIVLINCIDWVSKRELSSVDKLLIILAISRIGLIWEILVSWFLAL      1 - 70
HYLAIFVSGTGLRIMIFSWIVSNHFNLWLATIFSIFYLLKIASFSSPAFLYLKWRVNKVILMILLGTLVF     71 - 140
LFLNLIQINMHIKDWLDRYERNTTWNFSMSDFETFSVSVKFTMTMFSLTPFTVAFISFLLLIFSLQKHLQ    141 - 210
KMQLNYKGHRDPRTKVHTNALKIVISFLLFYASFFLCVLISWISELYQNTVIYMLCETIGVFSPSSHSFL    211 - 280
LILGNAKLRQAFLLVAAKVWAKR                                                   281 - 303
//

Text Mined References (17)

PMID Year Title