1. Home
  2. Targets
  3. GPCR
  4. Class A rhodopsin like
  5. Taste 2 receptor
  6. Taste receptor type 2 member 13

Tbio Taste receptor type 2 member 13

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5.

This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organized in the genome in clusters and are genetically linked to loci that influence bitter perception in mice and humans. In functional expression studies, they respond to bitter tastants. This gene maps to the taste receptor gene cluster on chromosome 12p13. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.56
PubTator Score 5.96

Knowledge Summary

Patent (7,737)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung cancer 4473 0.00690833719903523
Disease Target Count Z-score Confidence
Pelvic inflammatory disease 21 3.655 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.300 0.007

Synonym

Accession Q9NYV9 Q4G0I5 Q502V8 Q645X2 T2R13
Symbols TRB3
T2R13

Gene

TAS2R13

  Ortholog (3)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid

 Collection (1)

 GO Function (3)

 GO Component (2)

 GO Process (2)

 Compartment GO Term (9)

 HCA RNA Cell Line (26)

See all...

Pathway (8)

 UniProt Keyword (12)

See all...

Gene RIF (2)

PMID Text
25257701 Genetic variation in TRPV1 and TAS2Rs influence sensations from sampled EtOH and may potentially influence how individuals initially respond to alcoholic beverages.
22824251 It found a single nucleotide polymorphism (SNP) located within the TAS2R13 gene, which showed a significant association with measures of alcohol consumption assessed via the Alcohol Use Disorders Identification Test (AUDIT).

AA Sequence 

MESALPSIFTLVIIAEFIIGNLSNGFIVLINCIDWVSKRELSSVDKLLIILAISRIGLIWEILVSWFLAL      1 - 70
HYLAIFVSGTGLRIMIFSWIVSNHFNLWLATIFSIFYLLKIASFSSPAFLYLKWRVNKVILMILLGTLVF     71 - 140
LFLNLIQINMHIKDWLDRYERNTTWNFSMSDFETFSVSVKFTMTMFSLTPFTVAFISFLLLIFSLQKHLQ    141 - 210
KMQLNYKGHRDPRTKVHTNALKIVISFLLFYASFFLCVLISWISELYQNTVIYMLCETIGVFSPSSHSFL    211 - 280
LILGNAKLRQAFLLVAAKVWAKR                                                   281 - 303
//

Text Mined References (17)

PMID Year Title
25257701 2014 Polymorphisms in TRPV1 and TAS2Rs associate with sensations from sampled ethanol.
22888021 2012 G protein-coupled receptors participate in cytokinesis.
22824251 2012 Variation in the gene TAS2R13 is associated with differences in alcohol consumption in patients with head and neck cancer.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
More...