Property Summary

NCBI Gene PubMed Count 16
Grant Count 20
R01 Count 12
Funding $1,233,570.92
PubMed Score 2.56
PubTator Score 5.96

Knowledge Summary

Patent (7,737)

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.300 0.007

Gene RIF (2)

PMID Text
25257701 Genetic variation in TRPV1 and TAS2Rs influence sensations from sampled EtOH and may potentially influence how individuals initially respond to alcoholic beverages.
22824251 It found a single nucleotide polymorphism (SNP) located within the TAS2R13 gene, which showed a significant association with measures of alcohol consumption assessed via the Alcohol Use Disorders Identification Test (AUDIT).

AA Sequence

MESALPSIFTLVIIAEFIIGNLSNGFIVLINCIDWVSKRELSSVDKLLIILAISRIGLIWEILVSWFLAL      1 - 70
HYLAIFVSGTGLRIMIFSWIVSNHFNLWLATIFSIFYLLKIASFSSPAFLYLKWRVNKVILMILLGTLVF     71 - 140
LFLNLIQINMHIKDWLDRYERNTTWNFSMSDFETFSVSVKFTMTMFSLTPFTVAFISFLLLIFSLQKHLQ    141 - 210
KMQLNYKGHRDPRTKVHTNALKIVISFLLFYASFFLCVLISWISELYQNTVIYMLCETIGVFSPSSHSFL    211 - 280
LILGNAKLRQAFLLVAAKVWAKR                                                   281 - 303
//

Text Mined References (17)

PMID Year Title
25257701 2014 Polymorphisms in TRPV1 and TAS2Rs associate with sensations from sampled ethanol.
22888021 2012 G protein-coupled receptors participate in cytokinesis.
22824251 2012 Variation in the gene TAS2R13 is associated with differences in alcohol consumption in patients with head and neck cancer.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
More...