Tbio | Taste receptor type 2 member 13 |
Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5.
This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organized in the genome in clusters and are genetically linked to loci that influence bitter perception in mice and humans. In functional expression studies, they respond to bitter tastants. This gene maps to the taste receptor gene cluster on chromosome 12p13. [provided by RefSeq, Jul 2008]
This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organized in the genome in clusters and are genetically linked to loci that influence bitter perception in mice and humans. In functional expression studies, they respond to bitter tastants. This gene maps to the taste receptor gene cluster on chromosome 12p13. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
lung cancer | 4473 | 0.00690833719903523 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Pelvic inflammatory disease | 21 | 3.655 | 1.8 |
PMID | Text |
---|---|
25257701 | Genetic variation in TRPV1 and TAS2Rs influence sensations from sampled EtOH and may potentially influence how individuals initially respond to alcoholic beverages. |
22824251 | It found a single nucleotide polymorphism (SNP) located within the TAS2R13 gene, which showed a significant association with measures of alcohol consumption assessed via the Alcohol Use Disorders Identification Test (AUDIT). |
MESALPSIFTLVIIAEFIIGNLSNGFIVLINCIDWVSKRELSSVDKLLIILAISRIGLIWEILVSWFLAL 1 - 70 HYLAIFVSGTGLRIMIFSWIVSNHFNLWLATIFSIFYLLKIASFSSPAFLYLKWRVNKVILMILLGTLVF 71 - 140 LFLNLIQINMHIKDWLDRYERNTTWNFSMSDFETFSVSVKFTMTMFSLTPFTVAFISFLLLIFSLQKHLQ 141 - 210 KMQLNYKGHRDPRTKVHTNALKIVISFLLFYASFFLCVLISWISELYQNTVIYMLCETIGVFSPSSHSFL 211 - 280 LILGNAKLRQAFLLVAAKVWAKR 281 - 303 //
PMID | Year | Title |
---|---|---|
25257701 | 2014 | Polymorphisms in TRPV1 and TAS2Rs associate with sensations from sampled ethanol. |
22888021 | 2012 | G protein-coupled receptors participate in cytokinesis. |
22824251 | 2012 | Variation in the gene TAS2R13 is associated with differences in alcohol consumption in patients with head and neck cancer. |
20022913 | 2010 | The molecular receptive ranges of human TAS2R bitter taste receptors. |
17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. |
16959974 | 2006 | The consensus coding sequences of human breast and colorectal cancers. |
15744053 | 2005 | Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates. |
15496549 | 2005 | Evolution of bitter taste receptors in humans and apes. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
12581520 | 2003 | Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways. |
More... |