Property Summary

NCBI Gene PubMed Count 27
Grant Count 2
Funding $30,817.67
PubMed Score 19.74
PubTator Score 25.35

Knowledge Summary

Patent (2,582)

Synonym

Accession Q9NYV7 A4D0X2 Q502V3 Q549U8 Q645W1 T2R16
Symbols T2R16

Gene

 Grant Application (2)

Gene RIF (12)

PMID Text
25393978 Principal component analysis of binding energies for single-point mutants of hT2R16 bound to an agonist correlate with experimental mutant cell response.
24785689 No significant association between rs702424 alleles and salicin bitter taste recognition, implying that this site does not contribute to salicin phenotypic variance.
24177185 Results showed that individuals with at least one derived T-allele at polymorphic site 516 have a higher sensitivity to salicin bitterness compared with individuals homozygous for the ancestral G-allele.
23133589 Bitter taste receptor polymorphisms in TAS2R16 may be associated with human aging
21740153 The authors discuss the association between the TAS2R16 gene and the evolution of bitter taste receptors in different populations.
20965151 TAS2R16 is responsible for the bitterness of gentiobiose.
20605788 molecular interaction between hTAS2R16 and beta-D-glucopyranoside
18524836 Observational study of gene-disease association. (HuGE Navigator)
17250611 Observational study of gene-disease association. (HuGE Navigator)
17250611 Functional variants in both TAS2R16 and TAS2R38 correlate with alcohol consumption in African-American families.
More...

AA Sequence

MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQWASMLNNFCS      1 - 70
YFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRWRILRLFPWILLGSLMITCVT     71 - 140
IIPSAIGNYIQIQLLTMEHLPRNSTVTDKLENFHQYQFQAHTVALVIPFILFLASTIFLMASLTKQIQHH    141 - 210
STGHCNPSMKARFTALRSLAVLFIVFTSYFLTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSS    211 - 280
PTLKRILKGKC                                                               281 - 291
//

Text Mined References (28)

PMID Year Title
25393978 2015 Principal component analysis of binding energies for single-point mutants of hT2R16 bound to an agonist correlate with experimental mutant cell response.
24785689 2014 Limited evidence for adaptive evolution and functional effect of allelic variation at rs702424 in the promoter of the TAS2R16 bitter taste receptor gene in Africa.
24177185 2014 Origin and differential selection of allelic variation at TAS2R16 associated with salicin bitter taste sensitivity in Africa.
23133589 2012 Bitter taste receptor polymorphisms and human aging.
21740153 2011 Selection on the human bitter taste gene, TAS2R16, in Eurasian populations.
20965151 2010 The human bitter taste receptor, hTAS2R16, discriminates slight differences in the configuration of disaccharides.
20605788 2010 Characterization of the beta-D-glucopyranoside binding site of the human bitter taste receptor hTAS2R16.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
18524836 2008 Bitter taste receptor gene polymorphisms are an important factor in the development of nicotine dependence in African Americans.
17250611 2007 Functional variants in TAS2R38 and TAS2R16 influence alcohol consumption in high-risk families of African-American origin.
More...