Property Summary

NCBI Gene PubMed Count 27
PubMed Score 23.57
PubTator Score 25.35

Knowledge Summary

Patent (2,582)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Alcoholism 45 0.0 0.0
Disease Target Count
Alcoholic Intoxication, Chronic 289
Disease Target Count P-value
medulloblastoma, large-cell 6241 5.8e-04
Disease Target Count
Alcohol dependence 107

Gene RIF (12)

AA Sequence

MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQWASMLNNFCS      1 - 70
YFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRWRILRLFPWILLGSLMITCVT     71 - 140
IIPSAIGNYIQIQLLTMEHLPRNSTVTDKLENFHQYQFQAHTVALVIPFILFLASTIFLMASLTKQIQHH    141 - 210
STGHCNPSMKARFTALRSLAVLFIVFTSYFLTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSS    211 - 280
PTLKRILKGKC                                                               281 - 291
//

Text Mined References (28)

PMID Year Title