Property Summary

NCBI Gene PubMed Count 19
PubMed Score 49.02
PubTator Score 27.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
acute quadriplegic myopathy 1158 4.2e-06
psoriasis 6694 3.5e-05
group 4 medulloblastoma 1855 3.4e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy 1.182 4.2e-06
group 4 medulloblastoma 1.400 3.4e-04
psoriasis -2.000 3.5e-05

Protein-protein Interaction (9)

Gene RIF (8)

AA Sequence

MAAPLLHTRLPGDAAASSSAVKKLGASRTGISNMRALENDFFNSPPRKTVRFGGTVTEVLLKYKKGETND      1 - 70
FELLKNQLLDPDIKDDQIINWLLEFRSSIMYLTKDFEQLISIILRLPWLNRSQTVVEEYLAFLGNLVSAQ     71 - 140
TVFLRPCLSMIASHFVPPRVIIKEGDVDVSDSDDEDDNLPANFDTCHRALQIIARYVPSTPWFLMPILVE    141 - 210
KFPFVRKSERTLECYVHNLLRISVYFPTLRHEILELIIEKLLKLDVNASRQGIEDAEETATQTCGGTDST    211 - 280
EGLFNMDEDEETEHETKAGPERLDQMVHPVAERLDILMSLVLSYMKDVCYVDGKVDNGKTKDLYRDLINI    281 - 350
FDKLLLPTHASCHVQFFMFYLCSFKLGFAEAFLEHLWKKLQDPSNPAIIRQAAGNYIGSFLARAKFIPLI    351 - 420
TVKSCLDLLVNWLHIYLNNQDSGTKAFCDVALHGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLN    421 - 490
FERIVMSQLNPLKICLPSVVNFFAAITNKYQLVFCYTIIERNNRQMLPVIRSTAGGDSVQICTNPLDTFF    491 - 560
PFDPCVLKRSKKFIDPIYQVWEDMSAEELQEFKKPMKKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTH    561 - 630
FRSPSSSVGSPPVLYMQPSPL                                                     631 - 651
//

Text Mined References (27)

PMID Year Title