Property Summary

NCBI Gene PubMed Count 29
Grant Count 9
R01 Count 9
Funding $702,232.13
PubMed Score 24.33
PubTator Score 15.88

Knowledge Summary

Patent (2,754)

Expression

  Differential Expression (10)

Gene RIF (14)

PMID Text
26597175 Structures of CDK12/CycK complexes solved in the presence of AMP-PNP.
25712099 Data show that most mutations prevent formation of the cyclin-dependent kinase 12 (Cdk12)/cyclin K (CycK) complex, rendering the kinase inactive.
25561469 CDK12 and CDK13 losses in HCT116 cells preferentially affect expression of DNA damage response.
25429106 CDK12 affects RNA processing events in two distinct ways: Indirectly through generating factor-binding phospho-epitopes on the CTD of elongating RNAPII and directly through binding to specific factors
25384976 CDK12 plays an important role in cotranscriptional processing of c-FOS transcripts
24554720 many CDK12 mutations are an unrecognized cause of HR defects in ovarian cancers
24240700 CDK12 has properties that should confirm interest in its use as a biomarker.
22988298 Cyclin K1 is the primary cyclin partner for CDK12/CrkRS and it is required for activation of CDK12/CrkRS to phosphorylate the C-terminal domain of RNA Pol II.
22547058 CDK12 interacts with cyclin K and is required to maintain embryonnic stem cell self-renewal.
22012619 through regulation of expression of DNA damage response genes, CycK/Cdk12 protects cells from genomic instability
More...

AA Sequence

MPNSERHGGKKDGSGGASGTLQPSSGGGSSNSRERHRLVSKHKRHKSKHSKDMGLVTPEAASLGTVIKPL      1 - 70
VEYDDISSDSDTFSDDMAFKLDRRENDERRGSDRSDRLHKHRHHQHRRSRDLLKAKQTEKEKSQEVSSKS     71 - 140
GSMKDRISGSSKRSNEETDDYGKAQVAKSSSKESRSSKLHKEKTRKERELKSGHKDRSKSHRKRETPKSY    141 - 210
KTVDSPKRRSRSPHRKWSDSSKQDDSPSGASYGQDYDLSPSRSHTSSNYDSYKKSPGSTSRRQSVSPPYK    211 - 280
EPSAYQSSTRSPSPYSRRQRSVSPYSRRRSSSYERSGSYSGRSPSPYGRRRSSSPFLSKRSLSRSPLPSR    281 - 350
KSMKSRSRSPAYSRHSSSHSKKKRSSSRSRHSSISPVRLPLNSSLGAELSRKKKERAAAAAAAKMDGKES    351 - 420
KGSPVFLPRKENSSVEAKDSGLESKKLPRSVKLEKSAPDTELVNVTHLNTEVKNSSDTGKVKLDENSEKH    421 - 490
LVKDLKAQGTRDSKPIALKEEIVTPKETETSEKETPPPLPTIASPPPPLPTTTPPPQTPPLPPLPPIPAL    491 - 560
PQQPPLPPSQPAFSQVPASSTSTLPPSTHSKTSAVSSQANSQPPVQVSVKTQVSVTAAIPHLKTSTLPPL    561 - 630
PLPPLLPGDDDMDSPKETLPSKPVKKEKEQRTRHLLTDLPLPPELPGGDLSPPDSPEPKAITPPQQPYKK    631 - 700
RPKICCPRYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPIT    701 - 770
AIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFM    771 - 840
KQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGE    841 - 910
ERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRR    911 - 980
RLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQ    981 - 1050
RQSGVVVEEPPPSKTSRKETTSGTSTEPVKNSSPAPPQPAPGKVESGAGDAIGLADITQQLNQSELAVLL   1051 - 1120
NLLQSQTDLSIPQMAQLLNIHSNPEMQQQLEALNQSISALTEATSQQQDSETMAPEESLKEAPSAPVILP   1121 - 1190
SAEQTTLEASSTPADMQNILAVLLSQLMKTQEPAGSLEENNSDKNSGPQGPRRTPTMPQEEAAACPPHIL   1191 - 1260
PPEKRPPEPPGPPPPPPPPPLVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYST   1261 - 1330
RPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSLSHLGESSSYQGTGSVQFPGD   1331 - 1400
QDLRFARVPLALHPVVGQPFLKAEGSSNSVVHAETKLQNYGELGPGTTGASSSGAGLHWGGPTQSSAYGK   1401 - 1470
LYRGPTRVPPRGGRGRGVPY                                                     1471 - 1490
//

Text Mined References (44)

PMID Year Title
26597175 2015 Structures of the CDK12/CycK complex with AMP-PNP reveal a flexible C-terminal kinase extension important for ATP binding.
25712099 2015 Ovarian carcinoma CDK12 mutations misregulate expression of DNA repair genes via deficient formation and function of the Cdk12/CycK complex.
25561469 2015 Characterization of human cyclin-dependent kinase 12 (CDK12) and CDK13 complexes in C-terminal domain phosphorylation, gene transcription, and RNA processing.
25429106 2015 Expression, purification, and identification of associated proteins of the full-length hCDK12/CyclinK complex.
25384976 2015 Cyclin-dependent kinase 12 increases 3' end processing of growth factor-induced c-FOS transcripts.
24662513 2014 The structure and substrate specificity of human Cdk12/Cyclin K.
24554720 2014 Ovarian cancer-associated mutations disable catalytic activity of CDK12, a kinase that promotes homologous recombination repair and resistance to cisplatin and poly(ADP-ribose) polymerase inhibitors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24240700 2014 Genome-wide profiling of genetic synthetic lethality identifies CDK12 as a novel determinant of PARP1/2 inhibitor sensitivity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...