Property Summary

NCBI Gene PubMed Count 19
PubMed Score 41.04
PubTator Score 28.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 2.72546495452269E-28
Breast cancer 3099 3.37899469707767E-16
pilocytic astrocytoma 3086 9.57093054851036E-7
pediatric high grade glioma 2712 4.46223093865812E-6
ovarian cancer 8492 8.93113158886932E-6
osteosarcoma 7933 1.85761608802064E-5
medulloblastoma, large-cell 6234 3.40911841627288E-5
glioblastoma 5572 5.02049217067735E-5
psoriasis 6685 6.73686246853543E-4
lung cancer 4473 0.00139997460830968
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0377890995566407
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Dysentery 13 3.041 1.5

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis 1.300 0.001
osteosarcoma -1.652 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.187 0.038
non-small cell lung cancer 1.426 0.000
lung cancer 1.300 0.001
pediatric high grade glioma 1.100 0.000
pilocytic astrocytoma 1.100 0.000
Breast cancer 1.300 0.000
ovarian cancer 2.000 0.000

Synonym

Accession Q9NYU2 Q53QP2 Q53SL3 Q8IW30 Q9H8I4 UGT1
Symbols UGT1
HUGT1
UGCGL1

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (9)

PMID Text
26196150 Kyte-Doolittle analysis as well as homology modeling revealed a cluster of hydrophobic amino acids that may be functional in the folding sensing mechanism of HUGT1
25935482 Results indicate that glycan structures are similar to endogenous glycans at low expression levels of uridine 5'-diphosphate-glucose: glycoprotein glucosyltransferase (UGGT1).
25694454 A novel UGGT1- and p97-dependent protein quality checkpoint is shown. This checkpoint is alerted to prevent secretion of a polypeptide that passes the luminal quality control scrutiny by BiP and CNX but contains an intramembrane ionizable residue.
24415556 The UGGT1 is a well-documented enzyme which functions as a folding sensor in the endoplasmic reticulum, by the virtue of its ability to transfer a glucose residue to non-glucosylated high-mannose-type glycans of immature glycoproteins.
22190034 HIV-1 Env is identified to have a physical interaction with UDP-glucose glycoprotein glucosyltransferase 1 (UGGT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20498017 UGT1 aids in the folding of sequential domain-containing proteins such as prosaposin.
19466607 overexpression leads to increase in production of recombinant proteins; gene targeting
12913004 the amino-terminal 80% of HUGT1 is required for activation of the catalytic domain
12682060 The substrate binding specificity

AA Sequence

MGCKGDASGACAAGALPVTGVCYKMGVLVVLTVLWLFSSVKADSKAITTSLTTKWFSTPLLLEASEFLAE      1 - 70
DSQEKFWNFVEASQNIGSSDHDGTDYSYYHAILEAAFQFLSPLQQNLFKFCLSLRSYSATIQAFQQIAAD     71 - 140
EPPPEGCNSFFSVHGKKTCESDTLEALLLTASERPKPLLFKGDHRYPSSNPESPVVIFYSEIGSEEFSNF    141 - 210
HRQLISKSNAGKINYVFRHYIFNPRKEPVYLSGYGVELAIKSTEYKAKDDTQVKGTEVNTTVIGENDPID    211 - 280
EVQGFLFGKLRDLHPDLEGQLKELRKHLVESTNEMAPLKVWQLQDLSFQTAARILASPVELALVVMKDLS    281 - 350
QNFPTKARAITKTAVSSELRTEVEENQKYFKGTLGLQPGDSALFINGLHMDLDTQDIFSLFDVLRNEARV    351 - 420
MEGLHRLGIEGLSLHNVLKLNIQPSEADYAVDIRSPAISWVNNLEVDSRYNSWPSSLQELLRPTFPGVIR    421 - 490
QIRKNLHNMVFIVDPAHETTAELMNTAEMFLSNHIPLRIGFIFVVNDSEDVDGMQDAGVAVLRAYNYVAQ    491 - 560
EVDDYHAFQTLTHIYNKVRTGEKVKVEHVVSVLEKKYPYVEVNSILGIDSAYDRNRKEARGYYEQTGVGP    561 - 630
LPVVLFNGMPFEREQLDPDELETITMHKILETTTFFQRAVYLGELPHDQDVVEYIMNQPNVVPRINSRIL    631 - 700
TAERDYLDLTASNNFFVDDYARFTILDSQGKTAAVANSMNYLTKKGMSSKEIYDDSFIRPVTFWIVGDFD    701 - 770
SPSGRQLLYDAIKHQKSSNNVRISMINNPAKEISYENTQISRAIWAALQTQTSNAAKNFITKMAKEGAAE    771 - 840
ALAAGADIAEFSVGGMDFSLFKEVFESSKMDFILSHAVYCRDVLKLKKGQRAVISNGRIIGPLEDSELFN    841 - 910
QDDFHLLENIILKTSGQKIKSHIQQLRVEEDVASDLVMKVDALLSAQPKGDPRIEYQFFEDRHSAIKLRP    911 - 980
KEGETYFDVVAVVDPVTREAQRLAPLLLVLAQLINMNLRVFMNCQSKLSDMPLKSFYRYVLEPEISFTSD    981 - 1050
NSFAKGPIAKFLDMPQSPLFTLNLNTPESWMVESVRTPYDLDNIYLEEVDSVVAAEYELEYLLLEGHCYD   1051 - 1120
ITTGQPPRGLQFTLGTSANPVIVDTIVMANLGYFQLKANPGAWILRLRKGRSEDIYRIYSHDGTDSPPDA   1121 - 1190
DEVVIVLNNFKSKIIKVKVQKKADMVNEDLLSDGTSENESGFWDSFKWGFTGQKTEEVKQDKDDIINIFS   1191 - 1260
VASGHLYERFLRIMMLSVLKNTKTPVKFWFLKNYLSPTFKEFIPYMANEYNFQYELVQYKWPRWLHQQTE   1261 - 1330
KQRIIWGYKILFLDVLFPLVVDKFLFVDADQIVRTDLKELRDFNLDGAPYGYTPFCDSRREMDGYRFWKS   1331 - 1400
GYWASHLAGRKYHISALYVVDLKKFRKIAAGDRLRGQYQGLSQDPNSLSNLDQDLPNNMIHQVPIKSLPQ   1401 - 1470
EWLWCETWCDDASKKRAKTIDLCNNPMTKEPKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEK   1471 - 1540
TKEPSREGPQKREEL                                                          1541 - 1555
//

Text Mined References (25)

PMID Year Title
26808496 2016 Comparative Proteomics Reveals Important Viral-Host Interactions in HCV-Infected Human Liver Cells.
26196150 2015 Profiling Aglycon-Recognizing Sites of UDP-glucose:glycoprotein Glucosyltransferase by Means of Squarate-Mediated Labeling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25935482 2015 The relationship between glycan structures and expression levels of an endoplasmic reticulum-resident glycoprotein, UDP-glucose: Glycoprotein glucosyltransferase 1.
25694454 2015 A novel UGGT1 and p97-dependent checkpoint for native ectodomains with ionizable intramembrane residue.
24415556 2014 Both isoforms of human UDP-glucose:glycoprotein glucosyltransferase are enzymatically active.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...