Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 1.073 8.2e-04
chronic lymphosyte leukemia 1.100 2.2e-05
ependymoma 1.100 4.6e-02
gastric cancer 1.300 1.5e-02
hepatocellular carcinoma 1.400 1.9e-04
intraductal papillary-mucinous adenoma (... 1.100 2.1e-02
intraductal papillary-mucinous carcinoma... 1.400 4.0e-03
intraductal papillary-mucinous neoplasm ... 1.200 2.6e-02
lung cancer 1.300 1.7e-02
lung carcinoma 1.200 1.5e-23
malignant mesothelioma -1.500 2.0e-06
medulloblastoma 1.200 2.2e-05
medulloblastoma, large-cell -2.400 7.7e-05
osteosarcoma 1.704 3.3e-06
ovarian cancer -1.900 2.4e-06
pancreatic cancer 1.100 4.4e-03
primary pancreatic ductal adenocarcinoma 1.232 1.4e-02
primitive neuroectodermal tumor 1.100 6.0e-04
tuberculosis -1.400 5.7e-03

AA Sequence

MNMFKEAVTFKDVAVAFTEEELGLLGPAQRKLYRDVMVENFRNLLSVGHPPFKQDVSPIERNEQLWIMTT      1 - 70
ATRRQGNLGEKNQSKLITVQDRESEEELSCWQIWQQIANDLTRCQDSMINNSQCHKQGDFPYQVGTELSI     71 - 140
QISEDENYIVNKADGPNNTGNPEFPILRTQDSWRKTFLTESQRLNRDQQISIKNKLCQCKKGVDPIGWIS    141 - 210
HHDGHRVHKSEKSYRPNDYEKDNMKILTFDHNSMIHTGQKSYQCNECKKPFSDLSSFDLHQQLQSGEKSL    211 - 280
TCVERGKGFCYSPVLPVHQKVHVGEKLKCDECGKEFSQGAHLQTHQKVHVIEKPYKCKQCGKGFSRRSAL    281 - 350
NVHCKVHTAEKPYNCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSRNSHLQSHQRVHTGEKPYK    351 - 420
CEECGKGFICSSNLYIHQRVHTGEKPYKCEECGKGFSRPSSLQAHQGVHTGEKSYICTVCGKGFTLSSNL    421 - 490
QAHQRVHTGEKPYKCNECGKSFRRNSHYQVHLVVHTGEKPYKCEICGKGFSQSSYLQIHQKAHSIEKPFK    491 - 560
CEECGQGFNQSSRLQIHQLIHTGEKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFRQASNL    561 - 630
LAHQRVHSGEKPFKCEECGKSFGRSAHLQAHQKVHTGDKPYKCDECGKGFKWSLNLDMHQRVHTGEKPYK    631 - 700
CGECGKYFSQASSLQLHQSVHTGEKPYKCDVCGKVFSRSSQLQSHQRVHTGEKPYKCEICGKSFSWRSNL    701 - 770
TVHHRIHVGDKSYKSNRGGKNIRESTQEKKSIK                                         771 - 803
//

Text Mined References (6)

PMID Year Title