Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.49666618272918E-23
ovarian cancer 8492 5.7492598615059E-12
malignant mesothelioma 3163 1.9526344163293E-6
osteosarcoma 7933 3.33065417421093E-6
medulloblastoma 1524 2.18331850806688E-5
chronic lymphosyte leukemia 232 2.21110903648408E-5
tuberculosis and treatment for 6 months 686 3.68704269354821E-5
medulloblastoma, large-cell 6234 7.73954963808381E-5
hepatocellular carcinoma 550 1.90987379515704E-4
primitive neuroectodermal tumor 3031 5.96933399024282E-4
adrenocortical carcinoma 1427 8.19180299569276E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00125546792421789
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00397926119017603
pancreatic cancer 2300 0.0043783220226169
primary pancreatic ductal adenocarcinoma 1271 0.0141792471585433
gastric cancer 436 0.014516001947482
lung cancer 4473 0.0170929055294794
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0257623731970572
ependymoma 2514 0.0463812666650227

Expression

Synonym

Accession Q9NYT6 Q8WWE6 Q96TE6 Q9NS44
Symbols

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Pig OMA Inparanoid

AA Sequence

MNMFKEAVTFKDVAVAFTEEELGLLGPAQRKLYRDVMVENFRNLLSVGHPPFKQDVSPIERNEQLWIMTT      1 - 70
ATRRQGNLGEKNQSKLITVQDRESEEELSCWQIWQQIANDLTRCQDSMINNSQCHKQGDFPYQVGTELSI     71 - 140
QISEDENYIVNKADGPNNTGNPEFPILRTQDSWRKTFLTESQRLNRDQQISIKNKLCQCKKGVDPIGWIS    141 - 210
HHDGHRVHKSEKSYRPNDYEKDNMKILTFDHNSMIHTGQKSYQCNECKKPFSDLSSFDLHQQLQSGEKSL    211 - 280
TCVERGKGFCYSPVLPVHQKVHVGEKLKCDECGKEFSQGAHLQTHQKVHVIEKPYKCKQCGKGFSRRSAL    281 - 350
NVHCKVHTAEKPYNCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSRNSHLQSHQRVHTGEKPYK    351 - 420
CEECGKGFICSSNLYIHQRVHTGEKPYKCEECGKGFSRPSSLQAHQGVHTGEKSYICTVCGKGFTLSSNL    421 - 490
QAHQRVHTGEKPYKCNECGKSFRRNSHYQVHLVVHTGEKPYKCEICGKGFSQSSYLQIHQKAHSIEKPFK    491 - 560
CEECGQGFNQSSRLQIHQLIHTGEKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFRQASNL    561 - 630
LAHQRVHSGEKPFKCEECGKSFGRSAHLQAHQKVHTGDKPYKCDECGKGFKWSLNLDMHQRVHTGEKPYK    631 - 700
CGECGKYFSQASSLQLHQSVHTGEKPYKCDVCGKVFSRSSQLQSHQRVHTGEKPYKCEICGKSFSWRSNL    701 - 770
TVHHRIHVGDKSYKSNRGGKNIRESTQEKKSIK                                         771 - 803
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12743021 2003 Differential expansion of zinc-finger transcription factor loci in homologous human and mouse gene clusters.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.