Property Summary

NCBI Gene PubMed Count 11
Grant Count 9
R01 Count 9
Funding $980,422.09
PubMed Score 13.29
PubTator Score 8.37

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
21698244 expression of PLEK2, the strongest gene to classify melanoma patients, in CD45(-) subsets illustrates the importance of analyzing whole blood cells for biomarker studies
17658464 These results suggest that PLEK2 is involved in actin rearrangement in a PI 3-kinase dependent manner.
17008542 pleckstrin-2 uses its modular domains to bind to membrane-associated phosphatidylinositols generated by PI3K, whereby it coordinates with the actin cytoskeleton in lymphocyte spreading and immune synapse formation.
15865208 Pleckstrin 2 was cloned; its mRNA is widely expressed in a variety of cell lines.

AA Sequence

MEDGVLKEGFLVKRGHIVHNWKARWFILRQNTLVYYKLEGGRRVTPPKGRILLDGCTITCPCLEYENRPL      1 - 70
LIKLKTQTSTEYFLEACSREERDAWAFEITGAIHAGQPGKVQQLHSLRNSFKLPPHISLHRIVDKMHDSN     71 - 140
TGIRSSPNMEQGSTYKKTFLGSSLVDWLISNSFTASRLEAVTLASMLMEENFLRPVGVRSMGAIRSGDLA    141 - 210
EQFLDDSTALYTFAESYKKKISPKEEISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHY    211 - 280
YDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIK    281 - 350
KLT                                                                       351 - 353
//

Text Mined References (13)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21698244 2011 Transcriptome profiling of whole blood cells identifies PLEK2 and C1QB in human melanoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17658464 2007 Pleckstrin-2 selectively interacts with phosphatidylinositol 3-kinase lipid products and regulates actin organization and cell spreading.
17008542 2007 PI3K regulates pleckstrin-2 in T-cell cytoskeletal reorganization.
15865208 2005 Cloning, expression and chromosomal assignment of human pleckstrin 2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11911883 2002 Pleckstrin homology domains and the cytoskeleton.
More...