Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.29
PubTator Score 8.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
non-small cell lung cancer 2798 3.28933384911795E-14
lung adenocarcinoma 2714 2.3100479205962E-9
pancreatic cancer 2300 1.04270910972746E-6
malignant mesothelioma 3163 1.34672870883814E-6
cystic fibrosis 1670 2.28172818182821E-5
medulloblastoma, large-cell 6234 3.20516792376519E-5
interstitial cystitis 2299 9.79169358294724E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 2.80857407348841E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.51675606699822E-4
glioblastoma 5572 4.27058524108164E-4
adrenocortical carcinoma 1427 0.00230441433451981
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0151833120486389
aldosterone-producing adenoma 664 0.0157583781709915
adrenocortical adenoma 134 0.0204083565705509
osteosarcoma 7933 0.0246293551591057
Disease Target Count Z-score Confidence
Pyosalpinx 4 3.529 1.8
Clonorchiasis 15 3.474 1.7
Pyuria 6 3.353 1.7
Proctitis 11 3.266 1.6

Expression

Synonym

Accession Q9NYT0 Q96JT0
Symbols

Gene

PANTHER Protein Class (1)

PDB

1X1G  

  Ortholog (13)

Pathway (1)

Gene RIF (4)

PMID Text
21698244 expression of PLEK2, the strongest gene to classify melanoma patients, in CD45(-) subsets illustrates the importance of analyzing whole blood cells for biomarker studies
17658464 These results suggest that PLEK2 is involved in actin rearrangement in a PI 3-kinase dependent manner.
17008542 pleckstrin-2 uses its modular domains to bind to membrane-associated phosphatidylinositols generated by PI3K, whereby it coordinates with the actin cytoskeleton in lymphocyte spreading and immune synapse formation.
15865208 Pleckstrin 2 was cloned; its mRNA is widely expressed in a variety of cell lines.

AA Sequence

MEDGVLKEGFLVKRGHIVHNWKARWFILRQNTLVYYKLEGGRRVTPPKGRILLDGCTITCPCLEYENRPL      1 - 70
LIKLKTQTSTEYFLEACSREERDAWAFEITGAIHAGQPGKVQQLHSLRNSFKLPPHISLHRIVDKMHDSN     71 - 140
TGIRSSPNMEQGSTYKKTFLGSSLVDWLISNSFTASRLEAVTLASMLMEENFLRPVGVRSMGAIRSGDLA    141 - 210
EQFLDDSTALYTFAESYKKKISPKEEISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHY    211 - 280
YDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIK    281 - 350
KLT                                                                       351 - 353
//

Text Mined References (13)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21698244 2011 Transcriptome profiling of whole blood cells identifies PLEK2 and C1QB in human melanoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17658464 2007 Pleckstrin-2 selectively interacts with phosphatidylinositol 3-kinase lipid products and regulates actin organization and cell spreading.
17008542 2007 PI3K regulates pleckstrin-2 in T-cell cytoskeletal reorganization.
15865208 2005 Cloning, expression and chromosomal assignment of human pleckstrin 2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11911883 2002 Pleckstrin homology domains and the cytoskeleton.
More...