Property Summary

NCBI Gene PubMed Count 11
PubMed Score 14.26
PubTator Score 8.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (4)

AA Sequence

MEDGVLKEGFLVKRGHIVHNWKARWFILRQNTLVYYKLEGGRRVTPPKGRILLDGCTITCPCLEYENRPL      1 - 70
LIKLKTQTSTEYFLEACSREERDAWAFEITGAIHAGQPGKVQQLHSLRNSFKLPPHISLHRIVDKMHDSN     71 - 140
TGIRSSPNMEQGSTYKKTFLGSSLVDWLISNSFTASRLEAVTLASMLMEENFLRPVGVRSMGAIRSGDLA    141 - 210
EQFLDDSTALYTFAESYKKKISPKEEISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHY    211 - 280
YDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIK    281 - 350
KLT                                                                       351 - 353
//

Text Mined References (13)

PMID Year Title