Property Summary

NCBI Gene PubMed Count 10
PubMed Score 13.32
PubTator Score 10.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 4.0e-03
astrocytoma -1.300 4.2e-03
atypical teratoid / rhabdoid tumor -1.600 1.2e-07
Breast cancer 1.200 2.2e-05
Chronic Lymphocytic Leukemia 2.069 3.0e-04
ependymoma -1.100 4.9e-02
glioblastoma -1.200 6.6e-06
intraductal papillary-mucinous neoplasm ... 1.200 1.3e-02
lung carcinoma 1.600 2.7e-27
medulloblastoma, large-cell -2.800 6.0e-04
ovarian cancer 2.400 4.8e-05

Synonym

Accession Q9NYS7 B4DIE6 B4DPV6 Q9NRX9 WSB-2
Symbols SBA2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKS      1 - 70
RSSKNETKGRGSPKEKTLDCGQIVWGLAFSPWPSPPSRKLWARHHPQVPDVSCLVLATGLNDGQIKIWEV     71 - 140
QTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQVLSGHLQWVYCCSISPDCS    141 - 210
MLCSAAGEKSVFLWSMRSYTLIRKLEGHQSSVVSCDFSPDSALLVTASYDTNVIMWDPYTGERLRSLHHT    211 - 280
QVDPAMDDSDVHISSLRSVCFSPEGLYLATVADDRLLRIWALELKTPIAFAPMTNGLCCTFFPHGGVIAT    281 - 350
GTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMKEFLTYRTF                    351 - 404
//

Text Mined References (12)

PMID Year Title