Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.03
PubTator Score 7.74

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
25869366 It was demonstrated that elevated levels of mRNA for NKIRAS1 was significantly associated both with loss of methylation in NKIRAS1 CpG-islands and methylation in a number of miRNA genes.
23156677 Significant correlation was found between alterations of methylation status of miR-34b/c, miR-193a and the expression level of NKIRAS1 target gene in the primary lung tumors.
21302000 Low kappaB-Ras1 expression is associated with gliomas.
20693965 It was shown the decreased expression level of NKIRAS1 in Renal cell carcinoma
20693965 Observational study of gene-disease association. (HuGE Navigator)
18434448 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVE      1 - 70
LPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKIDLSEQRQVDAEVAQQWAK     71 - 140
SEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN                      141 - 192
//

Text Mined References (13)

PMID Year Title
25869366 2015 Upregulation of RHOA and NKIRAS1 genes in lung tumors is associated with loss of their methylation as well as with methylation of regulatory miRNA genes.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23156677 [Methylation of some miRNA genes is involved in the regulation of their target genes RAR-beta2 and NKIRAS1 expression in lung cancer].
21302000 2012 Prognostic significance of kappaB-Ras1 expression in gliomas.
20693965 2010 Genetic and epigenetic changes of NKIRAS1 gene in human renal cell carcinomas.
18434448 2009 Genetic variation in the nuclear factor kappaB pathway in relation to susceptibility to rheumatoid arthritis.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15024091 2004 Inhibition of NF-kappaB activity by IkappaBbeta in association with kappaB-Ras.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...