Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.23
PubTator Score 7.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.800 4.0e-05
astrocytic glioma -1.800 8.1e-03
atypical teratoid / rhabdoid tumor -2.300 1.2e-08
ependymoma -1.700 1.5e-02
glioblastoma -1.200 7.2e-05
lung carcinoma 1.200 4.7e-19
medulloblastoma -1.100 8.1e-04
medulloblastoma, large-cell -2.300 1.6e-06
oligodendroglioma -1.200 2.2e-02
pancreatic ductal adenocarcinoma liver m... -1.553 6.3e-03
primitive neuroectodermal tumor -1.300 6.4e-05
subependymal giant cell astrocytoma -1.206 2.9e-02

Synonym

Accession Q9NYS0 Q96K18
Symbols KBRAS1
kappaB-Ras1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (6)

AA Sequence

MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVE      1 - 70
LPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKIDLSEQRQVDAEVAQQWAK     71 - 140
SEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN                      141 - 192
//

Text Mined References (13)

PMID Year Title