Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.26
PubTator Score 1.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia 1.200 2.0e-03
atypical teratoid / rhabdoid tumor 1.200 8.5e-08
group 3 medulloblastoma 1.400 4.3e-06
lung cancer 1.300 5.3e-04
medulloblastoma, large-cell 1.700 2.4e-06
ovarian cancer 1.100 8.7e-05
primitive neuroectodermal tumor 1.300 6.4e-05

Synonym

Accession Q9NYR9 A6NCZ5 B3KNN0 B4DNM3 Q6PK52 Q96KC7 Q9NSX1
Symbols KBRAS2
kappaB-Ras2

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Protein-protein Interaction (7)

Gene RIF (3)

AA Sequence

MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAE      1 - 70
LPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAK     71 - 140
SEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG                       141 - 191
//

Text Mined References (11)

PMID Year Title