Property Summary

Ligand Count 1
NCBI Gene PubMed Count 13
PubMed Score 16.08
PubTator Score 65.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
nephrosclerosis -2.189 2.6e-02
pancreatic ductal adenocarcinoma liver m... -2.480 5.8e-03
psoriasis -1.500 8.5e-04

Gene RIF (3)

AA Sequence

MSLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEIS      1 - 70
APICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAAPEGLRWFQLYVHPDLQLNKQ     71 - 140
LIQRVESLGFKALVITLDTPVCGNRRHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSW    141 - 210
FQSITRLPIILKGILTKEDAELAVKHNVQGIIVSNHGGRQLDEVLASIDALTEVVAAVKGKIEVYLDGGV    211 - 280
RTGNDVLKALALGAKCIFLGRPILWGLACKGEHGVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSR    281 - 350
L//

Text Mined References (15)

PMID Year Title