Property Summary

NCBI Gene PubMed Count 12
PubMed Score 15.75
PubTator Score 65.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
nephrosclerosis -2.189 0.026
psoriasis -3.400 0.000
pancreatic ductal adenocarcinoma liver m... -2.480 0.006

Synonym

Accession Q9NYQ3 Q2TU86 Q5QP00 Q9UJS6 HAOX2
Symbols GIG16
HAOX2

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEIS      1 - 70
APICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAAPEGLRWFQLYVHPDLQLNKQ     71 - 140
LIQRVESLGFKALVITLDTPVCGNRRHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSW    141 - 210
FQSITRLPIILKGILTKEDAELAVKHNVQGIIVSNHGGRQLDEVLASIDALTEVVAAVKGKIEVYLDGGV    211 - 280
RTGNDVLKALALGAKCIFLGRPILWGLACKGEHGVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSR    281 - 350
L//

Text Mined References (14)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22658862 2012 Discovery of pyrazole carboxylic acids as potent inhibitors of rat long chain L-2-hydroxy acid oxidase.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
17299377 2007 Fetal hemoglobin in sickle cell anemia: genetic determinants of response to hydroxyurea.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...