Property Summary

NCBI Gene PubMed Count 19
PubMed Score 104.54
PubTator Score 22.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.082 7.1e-03
aldosterone-producing adenoma -1.094 9.6e-03
atypical teratoid/rhabdoid tumor 1.300 2.0e-04
glioblastoma 1.500 2.0e-05
group 3 medulloblastoma 1.500 7.9e-04
intraductal papillary-mucinous neoplasm ... 1.200 1.3e-03
lung adenocarcinoma 1.100 2.3e-08
lung cancer 1.500 1.6e-03
malignant mesothelioma 1.500 2.6e-06
medulloblastoma, large-cell 1.300 7.5e-04
nasopharyngeal carcinoma 1.200 1.3e-03
non-small cell lung cancer 1.528 3.8e-22
osteosarcoma -1.111 1.2e-02
ovarian cancer 1.200 1.5e-03
pediatric high grade glioma 1.400 1.2e-03
primitive neuroectodermal tumor 1.200 1.1e-03
psoriasis 1.100 8.3e-12

 GO Function (1)

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASMWSSMSEDASVADMERAQLE      1 - 70
EEAAAAEERPLVFLCSGCRRPLGDSLSWVASQEDTNCILLRCVSCNVSVDKEQKLSKREKENGCVLETLC     71 - 140
CAGCSLNLGYVYRCTPKNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMED    141 - 210
VLKALQMKLWEAESKLSFATCKS                                                   211 - 233
//

Text Mined References (25)

PMID Year Title