Property Summary

NCBI Gene PubMed Count 16
PubMed Score 100.96
PubTator Score 22.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Down syndrome 548
Muscle Weakness 92
Disease Target Count P-value
non-small cell lung cancer 2798 3.81291399870904E-22
psoriasis 6685 8.25495872398116E-12
lung adenocarcinoma 2714 2.28286737813574E-8
malignant mesothelioma 3163 2.55449643215307E-6
sonic hedgehog group medulloblastoma 1482 3.64211822617774E-6
glioblastoma 5572 1.96590709159847E-5
medulloblastoma, large-cell 6234 1.93357173477893E-4
atypical teratoid/rhabdoid tumor 1095 2.0076549285476E-4
lung cancer 4473 3.59622206076057E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.92277951838667E-4
primitive neuroectodermal tumor 3031 0.00107544769508397
pediatric high grade glioma 2712 0.00123663693204069
nasopharyngeal carcinoma 1056 0.00125452614614871
ovarian cancer 8492 0.00359983563647719
adrenocortical carcinoma 1427 0.00713367267217976
aldosterone-producing adenoma 664 0.00962091692188409
osteosarcoma 7933 0.0119367486849715
Disease Target Count Z-score Confidence
Suppurative periapical periodontitis 2 3.538 1.8
Hypoglycemia 81 3.283 1.6

Expression

Synonym

Accession Q9NYP9 B2R562 Q542Z0
Symbols B28
FASP1
C21orf45
C21orf46
MIS18alpha
hMis18alpha

Gene

  Ortholog (7)

 GO Function (1)

Gene RIF (3)

PMID Text
26942680 Stable binding of Mis18alpha-Mis18beta heterotetramer to centromeres in telophase licenses them for CENP-A deposition.
17199038 Three human proteins essential for centromere/kinetochore structure and function, hMis18alpha, hMis18beta, and M18BP1, the complex of which is accumulated specifically at the telophase-G1 centromere, are identified.[Mis18alpha, Mis18beta, M18BP1]
15881666 it is suggested that pp5644 physically bind to FASP1

AA Sequence

MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASMWSSMSEDASVADMERAQLE      1 - 70
EEAAAAEERPLVFLCSGCRRPLGDSLSWVASQEDTNCILLRCVSCNVSVDKEQKLSKREKENGCVLETLC     71 - 140
CAGCSLNLGYVYRCTPKNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMED    141 - 210
VLKALQMKLWEAESKLSFATCKS                                                   211 - 233
//

Text Mined References (21)

PMID Year Title
26942680 2016 Licensing of Centromeric Chromatin Assembly through the Mis18?-Mis18? Heterotetramer.
26921242 2016 Centromere localization and function of Mis18 requires Yippee-like domain-mediated oligomerization.
25416956 2014 A proteome-scale map of the human interactome network.
25036634 2014 Polo-like kinase 1 licenses CENP-A deposition at centromeres.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...