Property Summary

NCBI Gene PubMed Count 16
Grant Count 4
Funding $434,730.25
PubMed Score 100.96
PubTator Score 22.53

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NYP9 B2R562 Q542Z0
Symbols B28
FASP1
C21orf45
C21orf46
MIS18alpha
hMis18alpha

Gene

 GO Function (1)

Gene RIF (3)

PMID Text
26942680 Stable binding of Mis18alpha-Mis18beta heterotetramer to centromeres in telophase licenses them for CENP-A deposition.
17199038 Three human proteins essential for centromere/kinetochore structure and function, hMis18alpha, hMis18beta, and M18BP1, the complex of which is accumulated specifically at the telophase-G1 centromere, are identified.[Mis18alpha, Mis18beta, M18BP1]
15881666 it is suggested that pp5644 physically bind to FASP1

AA Sequence

MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASMWSSMSEDASVADMERAQLE      1 - 70
EEAAAAEERPLVFLCSGCRRPLGDSLSWVASQEDTNCILLRCVSCNVSVDKEQKLSKREKENGCVLETLC     71 - 140
CAGCSLNLGYVYRCTPKNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMED    141 - 210
VLKALQMKLWEAESKLSFATCKS                                                   211 - 233
//

Text Mined References (21)

PMID Year Title
26942680 2016 Licensing of Centromeric Chromatin Assembly through the Mis18?-Mis18? Heterotetramer.
26921242 2016 Centromere localization and function of Mis18 requires Yippee-like domain-mediated oligomerization.
25416956 2014 A proteome-scale map of the human interactome network.
25036634 2014 Polo-like kinase 1 licenses CENP-A deposition at centromeres.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...