Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 4.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 2.100 2.6e-05
astrocytic glioma 1.100 1.8e-02
Astrocytoma, Pilocytic 1.700 5.1e-06
atypical teratoid / rhabdoid tumor 1.800 7.1e-03
ependymoma 1.600 1.3e-04
glioblastoma 1.800 1.3e-04
ovarian cancer -3.900 4.0e-23
primitive neuroectodermal tumor 1.200 1.2e-02

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MAPPSRHCLLLISTLGVFALNCFTKGQKNSTLIFTRENTIRNCSCSADIRDCDYSLANLMCNCKTVLPLA      1 - 70
VERTSYNGHLTIWFTDTSALGHLLNFTLVQDLKLSLCSTNTLPTEYLAICGLKRLRINMEAKHPFPEQSL     71 - 140
LIHSGGDSDSREKPMWLHKGWQPCMYISFLDMALFNRDSAFKSYSIENVTSIANNFPDFSYFRTFPMPSN    141 - 210
KSYVVTFIY                                                                 211 - 219
//

Text Mined References (10)

PMID Year Title