Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 4.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.100 0.018
glioblastoma 2.000 0.001
ependymoma 1.600 0.000
atypical teratoid / rhabdoid tumor 1.800 0.007
primitive neuroectodermal tumor 1.200 0.012
adult high grade glioma 2.100 0.000
pilocytic astrocytoma 1.700 0.000
ovarian cancer -3.900 0.000

Synonym

Accession Q9NYP8 A8K4L8
Symbols B37
PRED81
C21orf120

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20494980 The C21orf120 promoter is activated by serum depletion according to promoter reporter assays in HEK 293 cells.

AA Sequence

MAPPSRHCLLLISTLGVFALNCFTKGQKNSTLIFTRENTIRNCSCSADIRDCDYSLANLMCNCKTVLPLA      1 - 70
VERTSYNGHLTIWFTDTSALGHLLNFTLVQDLKLSLCSTNTLPTEYLAICGLKRLRINMEAKHPFPEQSL     71 - 140
LIHSGGDSDSREKPMWLHKGWQPCMYISFLDMALFNRDSAFKSYSIENVTSIANNFPDFSYFRTFPMPSN    141 - 210
KSYVVTFIY                                                                 211 - 219
//

Text Mined References (10)

PMID Year Title
20639394 2010 Genome-wide association of serum bilirubin levels in Korean population.
20494980 2010 Functional analysis and identification of cis-regulatory elements of human chromosome 21 gene promoters.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036298 2002 Annotation of human chromosome 21 for relevance to Down syndrome: gene structure and expression analysis.
10830953 2000 The DNA sequence of human chromosome 21.
10773462 2000 Criteria for gene identification and features of genome organization: analysis of 6.5 Mb of DNA sequence from human chromosome 21.