Property Summary

NCBI Gene PubMed Count 33
PubMed Score 83.68
PubTator Score 20.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 3.321 4.7e-04
active ulcerative colitis 1.852 4.9e-03
acute quadriplegic myopathy 1.531 4.2e-06
Atopic dermatitis -1.400 5.1e-03
autosomal dominant Emery-Dreifuss muscul... 1.655 3.9e-03
Breast cancer 4.000 2.7e-02
chronic rhinosinusitis -1.175 1.6e-02
cystic fibrosis and chronic rhinosinusit... -1.110 3.8e-02
dermatomyositis 2.100 3.2e-04
Duchenne muscular dystrophy 1.532 1.9e-08
gastric carcinoma 2.000 4.6e-03
interstitial cystitis 1.200 5.1e-04
invasive ductal carcinoma -1.100 2.5e-02
juvenile dermatomyositis 1.261 7.0e-10
lung cancer -1.100 4.3e-03
Multiple myeloma 1.332 2.4e-02
osteosarcoma 1.029 6.9e-04
ovarian cancer -2.400 2.3e-05
pancreatic cancer 2.100 1.0e-03
primary pancreatic ductal adenocarcinoma 1.984 3.0e-03
primary Sjogren syndrome 1.600 4.6e-03
psoriasis -1.100 1.2e-03
Waldenstrons macroglobulinemia 1.401 3.2e-02

Gene RIF (14)

AA Sequence

MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFSCRGILVVYNL      1 - 70
GLTLLSLYMFCELVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQIT     71 - 140
VLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSVPSMRPYLWWKKYITQGQLLQF    141 - 210
VLTIIQTSCGVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGH    211 - 280
TNSFSPLENNVKPRKLRKD                                                       281 - 299
//

Text Mined References (38)

PMID Year Title