Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.41
PubTator Score 1.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.929 1.1e-05
atypical teratoid/rhabdoid tumor 1.200 1.1e-05
Breast cancer 2.200 4.3e-02
breast carcinoma 1.300 5.4e-34
ductal carcinoma in situ 1.300 8.2e-03
ependymoma 1.200 4.9e-02
group 3 medulloblastoma 1.500 3.6e-03
intraductal papillary-mucinous neoplasm ... 1.400 1.5e-03
invasive ductal carcinoma 1.100 3.8e-04
lung adenocarcinoma 1.400 4.1e-12
non-small cell lung cancer 1.606 4.1e-23
Pick disease -1.100 3.6e-04
ulcerative colitis 1.300 4.5e-07

AA Sequence

MALSVPGYSPGFRKPPEVVRLRRKRARSRGAAASPPRELTEPAARRAALVAGLPLRPFPAAGGRGGGSGG      1 - 70
GPAAARRNPFARLDNRPRVAAEPPDGPAREQPEAPVPFLDSNQENDLLWEEKFPERTTVTELPQTSHVSF     71 - 140
SEPDIPSSKSTELPVDWSIKTRLLFTSSQPFTWADHLKAQEEAQGLVQHCRATEVTLPKSIQDPKLSSEL    141 - 210
RCTFQQSLIYWLHPALSWLPLFPRIGADRKMAGKTSPWSNDATLQHVLMSDWSVSFTSLYNLLKTKLCPY    211 - 280
FYVCTYQFTVLFRAAGLAGSDLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE    281 - 350
QAISDEDEEESFSWLEEMGVQDKIKKPDILSIKLRKEKHEVQMDHRPESVVLVKGINTFTLLNFLINSKS    351 - 420
LVATSGPQAGLPPTLLSPVAFRGATMQMLKARSVNVKTQALSGYRDQFSLEITGPIMPHSLHSLTMLLKS    421 - 490
SQSGSFSAVLYPHEPTAVFNICLQMDKVLDMEVVHKELTNCGLHPNTLEQLSQIPLLGKSSLRNVVLRDY    491 - 560
IYNWRS                                                                    561 - 566
//

Text Mined References (15)

PMID Year Title