Property Summary

NCBI Gene PubMed Count 4
Grant Count 52
R01 Count 22
Funding $13,692,280.33
PubMed Score 568.73
PubTator Score 15.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
astrocytic glioma 1.800 0.025
oligodendroglioma 1.400 0.022
group 4 medulloblastoma -1.400 0.012
non-small cell lung cancer -1.719 0.000
colon cancer -1.100 0.000
lung cancer -1.500 0.001
atypical teratoid/rhabdoid tumor -1.200 0.006
non primary Sjogren syndrome sicca 1.100 0.026
lung adenocarcinoma -1.400 0.000
Breast cancer -1.100 0.000
invasive ductal carcinoma -1.100 0.002

 GO Function (1)

 GO Component (2)

 Compartment GO Term (1)

AA Sequence

MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYDPNLEDTYSSEETVDHQPVHL      1 - 70
RVMDTADLDTPRNCERYLNWAHAFLVVYSVDSRQSFDSSSSYLELLALHAKETQRSIPALLLGNKLDMAQ     71 - 140
YRQVTKAEGVALAGRFGCLFFEVSACLDFEHVQHVFHEAVREARRELEKSPLTRPLFISEERALPHQAPL    141 - 210
TARHGLASCTFNTLSTINLKEMPTVAQAKLVTVKSSRAQSKRKAPTLTLLKGFKIF                  211 - 266
//

Text Mined References (7)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107412 2002 Expressed sequence tag analysis of adult human iris for the NEIBank Project: steroid-response factors and similarities with retinal pigment epithelium.