Property Summary

NCBI Gene PubMed Count 4
PubMed Score 638.33
PubTator Score 15.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.800 2.5e-02
atypical teratoid/rhabdoid tumor -1.200 6.3e-03
Breast cancer -1.100 1.0e-09
colon cancer -1.100 3.4e-04
group 4 medulloblastoma -1.400 1.2e-02
invasive ductal carcinoma -1.100 2.1e-03
lung adenocarcinoma -1.400 4.3e-09
lung cancer -1.500 5.9e-04
malignant mesothelioma 1.300 1.8e-06
non primary Sjogren syndrome sicca 1.100 2.6e-02
non-small cell lung cancer -1.719 4.5e-18
oligodendroglioma 1.400 2.2e-02

 GO Component (1)

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYDPNLEDTYSSEETVDHQPVHL      1 - 70
RVMDTADLDTPRNCERYLNWAHAFLVVYSVDSRQSFDSSSSYLELLALHAKETQRSIPALLLGNKLDMAQ     71 - 140
YRQVTKAEGVALAGRFGCLFFEVSACLDFEHVQHVFHEAVREARRELEKSPLTRPLFISEERALPHQAPL    141 - 210
TARHGLASCTFNTLSTINLKEMPTVAQAKLVTVKSSRAQSKRKAPTLTLLKGFKIF                  211 - 266
//

Text Mined References (7)

PMID Year Title