Property Summary

NCBI Gene PubMed Count 24
PubMed Score 0.65
PubTator Score 11.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 2.89445483466307E-4
ovarian cancer 8492 0.00140984265125144
Disease Target Count Z-score Confidence
Uterine fibroid 29 3.75 1.9
Hemolytic anemia 70 0.0 2.0
Intracranial aneurysm 20 0.0 1.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.235 0.000
ovarian cancer 1.200 0.001

Synonym

Accession Q9NYM9 B3KMY0
Symbols GS15
BET1L1
GOLIM3
HSPC197

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (3)

PMID Text
23892540 Meta-analysis showed a strong association at blocked early in transport 1 homolog (BET1L) rs2280543 for intramural uterine fibroid type in european americans.
23604678 single nucleotide polymorphisms in the BET1L gene is associated with uterine fibroid.
12388752 Data suggest that GS15 exists in a distinct SNARE complex that contains syntaxin5, GS28, and Ykt6, and may be involved in both ER-to-Golgi and intra-Golgi transport.

AA Sequence

MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMDSDFTSMTSLLTGS      1 - 70
VKRFSTMARSGQDNRKLLCGMAVGLIVAFFILSYFLSRART                                  71 - 111
//

Text Mined References (31)

PMID Year Title
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23892540 2013 Variants in BET1L and TNRC6B associate with increasing fibroid volume and fibroid type among European Americans.
23604678 2013 BET1L and TNRC6B associate with uterine fibroid risk among European Americans.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22286173 2012 Genome-wide association study for intracranial aneurysm in the Japanese population identifies three candidate susceptible loci and a functional genetic variant at EDNRA.
21460842 2011 A genome-wide association study identifies three loci associated with susceptibility to uterine fibroids.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...