Property Summary

NCBI Gene PubMed Count 24
PubMed Score 0.87
PubTator Score 11.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.9e-04
ovarian cancer 8520 1.4e-03
Disease Target Count Z-score Confidence
Uterine fibroid 28 3.37 1.7
Hemolytic anemia 77 0.0 3.0
Intracranial aneurysm 24 0.0 1.2

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.235 2.9e-04
ovarian cancer 1.200 1.4e-03

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMDSDFTSMTSLLTGS      1 - 70
VKRFSTMARSGQDNRKLLCGMAVGLIVAFFILSYFLSRART                                  71 - 111
//

Text Mined References (31)

PMID Year Title