Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.80
PubTator Score 12.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 2.29650713213882E-9
ependymoma 2514 8.62434117196557E-9
osteosarcoma 7933 1.01898330184919E-7
atypical teratoid / rhabdoid tumor 4369 1.58211610911979E-5
medulloblastoma, large-cell 6234 1.66209055383231E-5
psoriasis 6685 2.59094945850344E-5
pediatric high grade glioma 2712 0.00103279344054909
ovarian cancer 8492 0.00178157166089634
glioblastoma 5572 0.00259463399692461
group 4 medulloblastoma 1875 0.00287559891358421
primary pancreatic ductal adenocarcinoma 1271 0.0117141136442695
aldosterone-producing adenoma 664 0.0243308617964071
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0291425738645405
spina bifida 1064 0.0373936224288373

Expression

  Differential Expression (14)

Synonym

Accession Q9NYL9 B2R6G7 Q9NT43 Q9NZR0
Symbols UTMOD

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Pig OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (5)

PMID Text
22158085 investigation of biomarkers for early diagnosis of endometriosis: Data suggest that TMOD3, tropomyosin 3, and stomatin-like protein 2 are autoantigens present in blood of women with endometriosis; immunodominant epitopes were identified.
17928307 findings show that the pointed-end capping protein Tmod3 contributes to epithelial cell shape within confluent monolayers of polarized epithelial cells
17012745 the Tmod3 isoform may regulate actin dynamics differently in cells than the previously described tropomodulin isoforms
15095301 levels of TM1, TM2 and TM3 are reduced in human transitional cell carcinoma cells, but significantly upregulated by inhibition of the mitogen-activated protein kinase-signaling pathway
12707310 capping of actin filament pointed ends by Tmod3 inhibits cell migration and reveal a novel control mechanism for regulation of actin filaments in lamellipodia.

AA Sequence

MALPFRKDLEKYKDLDEDELLGNLSETELKQLETVLDDLDPENALLPAGFRQKNQTSKSTTGPFDREHLL      1 - 70
SYLEKEALEHKDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELEEALTSASDTELCDLAAILGM     71 - 140
HNLITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKENDAHLVEVNLNNIKN    141 - 210
IPIPTLKDFAKALETNTHVKCFSLAATRSNDPVATAFAEMLKVNKTLKSLNVESNFITGVGILALIDALR    211 - 280
DNETLAELKIDNQRQQLGTAVELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGD    281 - 350
HQ                                                                        351 - 352
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22158085 2012 Identification and validation of novel serum markers for early diagnosis of endometriosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...