Property Summary

NCBI Gene PubMed Count 13
PubMed Score 12.95
PubTator Score 12.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.300 1.5e-03
aldosterone-producing adenoma -1.149 2.4e-02
atypical teratoid / rhabdoid tumor 1.500 1.6e-05
ependymoma 1.700 8.6e-09
glioblastoma 1.600 2.6e-03
group 4 medulloblastoma 1.200 2.9e-03
intraductal papillary-mucinous neoplasm ... 1.600 2.0e-02
juvenile dermatomyositis 1.079 2.3e-09
medulloblastoma, large-cell 1.500 1.7e-05
osteosarcoma -2.223 1.0e-07
ovarian cancer 1.200 1.0e-06
primary pancreatic ductal adenocarcinoma 1.291 1.2e-02
psoriasis 1.400 2.6e-05
spina bifida -2.216 4.0e-02

Gene RIF (6)

AA Sequence

MALPFRKDLEKYKDLDEDELLGNLSETELKQLETVLDDLDPENALLPAGFRQKNQTSKSTTGPFDREHLL      1 - 70
SYLEKEALEHKDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELEEALTSASDTELCDLAAILGM     71 - 140
HNLITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKENDAHLVEVNLNNIKN    141 - 210
IPIPTLKDFAKALETNTHVKCFSLAATRSNDPVATAFAEMLKVNKTLKSLNVESNFITGVGILALIDALR    211 - 280
DNETLAELKIDNQRQQLGTAVELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGD    281 - 350
HQ                                                                        351 - 352
//

Text Mined References (24)

PMID Year Title