Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.36
PubTator Score 5.41

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NYL4 B4DWB7 PPIase FKBP11
Symbols FKBP19

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
23749938 results suggest a progressively elevated expression of FKBP11 during the development of hepatocellular carcinoma

AA Sequence

MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVD      1 - 70
GRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVEL     71 - 140
IALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK             141 - 201
//

Text Mined References (11)

PMID Year Title
23749938 2013 Identification of FKBP11 as a biomarker for hepatocellular carcinoma.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
16596453 2006 The human FK506-binding proteins: characterization of human FKBP19.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...