Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.36
PubTator Score 5.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
periodontitis 269 3.95181534071661E-30
pituitary cancer 1972 3.91819501088071E-10
non-small cell lung cancer 2798 2.07940126959452E-8
ulcerative colitis 2087 3.68476346123493E-7
posterior fossa group A ependymoma 1511 1.80526432951059E-6
interstitial cystitis 2299 3.53258155166906E-5
ovarian cancer 8492 1.34822003436145E-4
medulloblastoma, large-cell 6234 3.57941929542037E-4
atypical teratoid / rhabdoid tumor 4369 0.00179422661179118
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00185059111829318
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00310319867425543
pediatric high grade glioma 2712 0.00423945463671618
pancreatic cancer 2300 0.006452576038092
active Crohn's disease 918 0.00684328288189981
acute myeloid leukemia 785 0.00700046154391347
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00998693312097742
lung cancer 4473 0.0139420630937443
glioblastoma 5572 0.0146270919442684
esophageal adenocarcinoma 737 0.0191101200705699
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0221953857499768
subependymal giant cell astrocytoma 2287 0.0370630634956746
Barrett's esophagus 185 0.0393127836884359
non primary Sjogren syndrome sicca 840 0.0427729409192727

Expression

Synonym

Accession Q9NYL4 B4DWB7 PPIase FKBP11
Symbols FKBP19

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
23749938 results suggest a progressively elevated expression of FKBP11 during the development of hepatocellular carcinoma

AA Sequence

MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVD      1 - 70
GRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVEL     71 - 140
IALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK             141 - 201
//

Text Mined References (11)

PMID Year Title
23749938 2013 Identification of FKBP11 as a biomarker for hepatocellular carcinoma.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
16596453 2006 The human FK506-binding proteins: characterization of human FKBP19.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...