Property Summary

NCBI Gene PubMed Count 36
PubMed Score 13.58
PubTator Score 171.02

Knowledge Summary

Patent (22,285)

Synonym

Accession Q9NYL2 B3KPG2 Q53SX1 Q580W8 Q59GY5 Q86YW8 Q9HCC4 Q9HCC5 Q9HDD2 Q9NYE9
Symbols pk
AZK
MLT
MRK
ZAK
MLK7
MLTK
SFMMP
mlklak
MLTKbeta
MLTKalpha

Gene

PDB

5HES  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (15)

PMID Text
26755636 ZAK is a key player in mammalian limb patterning in humans and mice.
25013376 The long non-coding RNA URHC promotes cell proliferation and inhibits apoptosis by repressing ZAK expression through inactivation of the ERK/MAPK pathway.
24807215 ZAK kinase isoform TV1 is preferentially upregulated in gastric tumours and cell lines relative to normal samples. This pattern is also observed in colorectal, bladder and breast cancers.
24170769 we report that sorafenib suppresses UV-induced apoptosis specifically by inhibiting c-jun-NH(2)-kinase (JNK) activation through the off-target inhibition of leucine zipper and sterile alpha motif-containing kinase (ZAK)
23319595 MRK is a novel RhoC effector that controls LPA-stimulated cell invasion at least in part by regulating myosin dynamics, ERK and p38
21305317 The genes identified KTN1, ROCK1, and ZAK may be responsible for loss of cellular homeostasis in giant cells tumors of bone
20408143 In this study, by applying a novel method, we have identified the phosphorylation sites in human MSK1 mitogen- and stress-activated protein kinase 1, and show that MRK-beta could also activate MSK1 through direct interaction.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20331627 decrease of lung cancer cell proliferation by ZAK may involve the ERK and JNK pathways via an AP-1 transcription factor.
18331592 data demonstrate that a ZAK isoform(s) is the MAP3Kinase that transduces the ribotoxic stress response
More...

AA Sequence

MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYG      1 - 70
VILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVV     71 - 140
IAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLE    141 - 210
GLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNK    211 - 280
AEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPLLPSFEIGAWTEDDVYCWVQQ    281 - 350
LVRKGDSSAEMSVYASLFKENNITGKRLLLLEEEDLKDMGIVSKGHIIHFKSAIEKLTHDYINLFHFPPL    351 - 420
IKDSGGEPEENEEKIVNLELVFGFHLKPGTGPQDCKWKMYMEMDGDEIAITYIKDVTFNTNLPDAEILKM    421 - 490
TKPPFVMEKWIVGIAKSQTVECTVTYESDVRTPKSTKHVHSIQWSRTKPQDEVKAVQLAIQTLFTNSDGN    491 - 560
PGSRSDSSADCQWLDTLRMRQIASNTSLQRSQSNPILGSPFFSHFDGQDSYAAAVRRPQVPIKYQQITPV    561 - 630
NQSRSSSPTQYGLTKNFSSLHLNSRDSGFSSGNTDTSSERGRYSDRSRNKYGRGSISLNSSPRGRYSGKS    631 - 700
QHSTPSRGRYPGKFYRVSQSALNPHQSPDFKRSPRDLHQPNTIPGMPLHPETDSRASEEDSKVSEGGWTK    701 - 770
VEYRKKPHRPSPAKTNKERARGDHRGWRNF                                            771 - 800
//

Text Mined References (47)

PMID Year Title
26755636 2016 Exome sequencing and CRISPR/Cas genome editing identify mutations of ZAK as a cause of limb defects in humans and mice.
25416956 2014 A proteome-scale map of the human interactome network.
25013376 2014 Long non-coding RNA URHC regulates cell proliferation and apoptosis via ZAK through the ERK/MAPK signaling pathway in hepatocellular carcinoma.
24807215 2014 Integrated exome and transcriptome sequencing reveals ZAK isoform usage in gastric cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24170769 2014 Sorafenib suppresses JNK-dependent apoptosis through inhibition of ZAK.
23319595 2013 The MLK-related kinase (MRK) is a novel RhoC effector that mediates lysophosphatidic acid (LPA)-stimulated tumor cell invasion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...