Property Summary

NCBI Gene PubMed Count 9
PubMed Score 39.75
PubTator Score 14.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 1.400 1.4e-03
hepatocellular carcinoma 1.400 2.0e-05
Multiple myeloma 1.259 2.9e-02
malignant mesothelioma 1.100 5.9e-05
psoriasis 1.100 6.7e-06
oligodendroglioma -1.200 1.8e-04
osteosarcoma 1.051 2.3e-02
atypical teratoid / rhabdoid tumor 1.200 7.6e-04
glioblastoma 1.300 4.0e-04
sonic hedgehog group medulloblastoma 1.400 3.4e-03
medulloblastoma, large-cell 1.100 3.5e-04
primitive neuroectodermal tumor 1.200 1.4e-03
juvenile dermatomyositis 1.801 2.1e-15
lung carcinoma -1.600 2.3e-15
ovarian cancer 1.200 2.1e-05

Gene RIF (2)

PMID Text
22039568 Two complementary techniques identified C21orf91 as a gene of interest for susceptibility to herpes simplex labialis.
12815627 Authors demonstrate that human AL109761 is in fact the human ortholog of chicken EURL (GeneID: 395489)

AA Sequence

MNEEEQFVNIDLNDDNICSVCKLGTDKETLSFCHICFELNIEGVPKSDLLHTKSLRGHKDCFEKYHLIAN      1 - 70
QGCPRSKLSKSTYEEVKTILSKKINWIVQYAQNKDLDSDSECSKNPQHHLFNFRHKPEEKLLPQFDSQVP     71 - 140
KYSAKWIDGSAGGISNCTQRILEQRENTDFGLSMLQDSGATLCRNSVLWPHSHNQAQKKEETISSPEANV    141 - 210
QTQHPHYSREELNSMTLGEVEQLNAKLLQQIQEVFEELTHQVQEKDSLASQLHVRHVAIEQLLKNCSKLP    211 - 280
CLQVGRTGMKSHLPINN                                                         281 - 297
//

Text Mined References (11)

PMID Year Title
27404227 2016 The HSA21 gene EURL/C21ORF91 controls neurogenesis within the cerebral cortex and is implicated in the pathogenesis of Down Syndrome.
22039568 2011 C21orf91 genotypes correlate with herpes simplex labialis (cold sore) frequency: description of a cold sore susceptibility gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12815627 2003 Isolation of a novel cDNA enriched in the undifferentiated chick retina and lens.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10830953 2000 The DNA sequence of human chromosome 21.
9828130 1998 Cloning of ARE-containing genes by AU-motif-directed display.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.