Property Summary

NCBI Gene PubMed Count 9
PubMed Score 39.75
PubTator Score 14.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 1.400 0.001
hepatocellular carcinoma 1.400 0.000
Multiple myeloma 1.259 0.029
malignant mesothelioma 1.100 0.000
psoriasis 1.100 0.000
oligodendroglioma -1.200 0.000
osteosarcoma 1.051 0.023
atypical teratoid / rhabdoid tumor 1.200 0.001
glioblastoma 1.300 0.000
sonic hedgehog group medulloblastoma 1.400 0.003
medulloblastoma, large-cell 1.100 0.000
primitive neuroectodermal tumor 1.200 0.001
juvenile dermatomyositis 1.801 0.000
lung carcinoma -1.600 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q9NYK6 B2RB30 Q96BK9 Q9H8C6
Symbols EURL
YG81
CSSG1
C21orf14
C21orf38

Gene

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
22039568 Two complementary techniques identified C21orf91 as a gene of interest for susceptibility to herpes simplex labialis.
12815627 Authors demonstrate that human AL109761 is in fact the human ortholog of chicken EURL (GeneID: 395489)

AA Sequence

MNEEEQFVNIDLNDDNICSVCKLGTDKETLSFCHICFELNIEGVPKSDLLHTKSLRGHKDCFEKYHLIAN      1 - 70
QGCPRSKLSKSTYEEVKTILSKKINWIVQYAQNKDLDSDSECSKNPQHHLFNFRHKPEEKLLPQFDSQVP     71 - 140
KYSAKWIDGSAGGISNCTQRILEQRENTDFGLSMLQDSGATLCRNSVLWPHSHNQAQKKEETISSPEANV    141 - 210
QTQHPHYSREELNSMTLGEVEQLNAKLLQQIQEVFEELTHQVQEKDSLASQLHVRHVAIEQLLKNCSKLP    211 - 280
CLQVGRTGMKSHLPINN                                                         281 - 297
//

Text Mined References (11)

PMID Year Title
27404227 2016 The HSA21 gene EURL/C21ORF91 controls neurogenesis within the cerebral cortex and is implicated in the pathogenesis of Down Syndrome.
22039568 2011 C21orf91 genotypes correlate with herpes simplex labialis (cold sore) frequency: description of a cold sore susceptibility gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12815627 2003 Isolation of a novel cDNA enriched in the undifferentiated chick retina and lens.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10830953 2000 The DNA sequence of human chromosome 21.
9828130 1998 Cloning of ARE-containing genes by AU-motif-directed display.
More...