Property Summary

NCBI Gene PubMed Count 250
Grant Count 557
R01 Count 214
Funding $114,598,152.64
PubMed Score 974.19
PubTator Score 545.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
gastric cancer 1.200 0.012
hepatocellular carcinoma 1.800 0.000
pancreatic cancer 1.300 0.014
cutaneous lupus erythematosus 3.800 0.000
osteosarcoma -1.705 0.030
glioblastoma 1.400 0.025
medulloblastoma, large-cell -1.500 0.000
tuberculosis 1.800 0.004
non-small cell lung cancer -1.003 0.000
lung cancer -2.300 0.000
group 3 medulloblastoma -1.100 0.002
pilocytic astrocytoma 1.600 0.000
primary Sjogren syndrome 1.700 0.000
pancreatic carcinoma 1.300 0.014
lung carcinoma -1.400 0.000
ovarian cancer -1.900 0.000

Synonym

Accession Q9NYK1 D1CS69 Q9NR98
Symbols TLR7-like

Gene

PANTHER Protein Class (1)

Gene RIF (237)

PMID Text
26903634 Data show that differences in codon bias limit Toll-like receptor 7 (TLR7) expression relative to Toll-like receptor 9 (TLR9).
26741133 TLR7 rs179008 showed some associations with post-bronchiolitis lung function deficiency, and polymorphisms of TLR4 rs4986790, and TLR6 rs5743810 in particular, with airway reactivity.
26725554 TLR7 and 8 polymorphisms may play a considerable role in the pathogenesis of asthma.
26723518 Increased expression of TLR7 and TLR9 in myasthenia gravis thymus is accompanied by active Epstein-Barr virus infection.
26718740 activation of TLR7 upregulated the expression levels of IFN-lambda1 and MMP-9 were increased by ~3 fold, whereas other genes (p53, PTEN, TIMP-1) were upregulated by ~2 fold, and VEGF was marginally upregulated after 10 min.
26512111 Conventional dendritic cell expression of TLR7 is essential for severe autoimmunity in the Sle1Tg7 model of systemic lupus erythematosus.
26483222 TLR7 and TLR8 may be involved in the pathogenesis of brain and lung damages caused by severe EV71 infection.
26371257 These results indicated that thiostrepton is a novel TLR7-9 inhibitor
26363072 Cardiac RNA induces inflammatory responses in cardiomyocytes and immune cells via MyD88-TLR7 signaling.
26340429 NADPH oxidase-deficient patient-derived B cells also expressed enhanced levels of TLR7 and TLR9 mRNA and protein compared with the same cells reconstituted to restore oxidase activity.
More...

AA Sequence

MVFPMWTLKRQILILFNIILISKLLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNL      1 - 70
TLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGLTYLKSLYLDGNQLL     71 - 140
EIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLS    141 - 210
LKDNNVTAVPTVLPSTLTELYLYNNMIAKIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQ    211 - 280
IPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLSFN    281 - 350
FELQVYRASMNLSQAFSSLKSLKILRIRGYVFKELKSFNLSPLHNLQNLEVLDLGTNFIKIANLSMFKQF    351 - 420
KRLKVIDLSVNKISPSGDSSEVGFCSNARTSVESYEPQVLEQLHYFRYDKYARSCRFKNKEASFMSVNES    421 - 490
CYKYGQTLDLSKNSIFFVKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQPLAELRYLDFSNNRLDLLHST    491 - 560
AFEELHKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNH    561 - 630
LDVLWREGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWKKLQCLKN    631 - 700
LETLDLSHNQLTTVPERLSNCSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPEN    701 - 770
VLNNLKMLLLHHNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTNL    771 - 840
ILFSLSISVSLFLMVMMTASHLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTKDPAVTEWVLA    841 - 910
ELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTENFKIAFYLSHQRLMD    911 - 980
EKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVAYSQVFKETV     981 - 1049
//

Text Mined References (250)

PMID Year Title
26903634 2016 Differences in codon bias and GC content contribute to the balanced expression of TLR7 and TLR9.
26741133 2016 Gene Polymorphism of Toll-Like Receptors and Lung Function at Five to Seven Years of Age after Infant Bronchiolitis.
26725554 2015 Associations of Toll-like receptor 7 and 8 Polymorphisms with Asthma and Asthma-related Phenotypes in a Chinese Han Population.
26723518 2016 Increased expression of Toll-like receptors 7 and 9 in myasthenia gravis thymus characterized by active Epstein-Barr virus infection.
26718740 2016 Activation of Toll-like receptor 7 regulates the expression of IFN-?1, p53, PTEN, VEGF, TIMP-1 and MMP-9 in pancreatic cancer cells.
26512111 2015 RNA sensing by conventional dendritic cells is central to the development of lupus nephritis.
26483222 2015 [Expression and significance of toll-like receptors 7 and 8 in brain and lung tissues of death cases caused by EV71 infection].
26371257 2015 Identification of Thiostrepton as a Novel Inhibitor for Psoriasis-like Inflammation Induced by TLR7-9.
26363072 2015 Cardiac RNA induces inflammatory responses in cardiomyocytes and immune cells via Toll-like receptor 7 signaling.
26340429 2015 Hyper-responsive Toll-like receptor 7 and 9 activation in NADPH oxidase-deficient B lymphoblasts.
More...