Property Summary

NCBI Gene PubMed Count 77
PubMed Score 75.23
PubTator Score 28.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.600 5.1e-03
dermatomyositis -1.200 1.6e-03
ependymoma 1.400 1.7e-02
Gaucher disease type 3 -1.100 2.9e-03
medulloblastoma, large-cell -1.300 7.0e-05
oligodendroglioma 1.400 1.0e-02
osteosarcoma 2.657 7.5e-09
ovarian cancer -1.600 2.5e-06
Pick disease 1.300 1.3e-05
psoriasis -1.300 1.3e-04

Protein-protein Interaction (3)

Gene RIF (45)

AA Sequence

MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSGISG      1 - 70
LRNHMTSLNLDLQSQNIYHHGREGSRMNGSRTLTHSISDGQLQGGQSNSELFQQEPQTAPAQVPQGFNVF     71 - 140
GMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVTLAPNIQTGRNTPTSLHIHGVPPPVLNSPQG    141 - 210
NSIYIRPYITTPGGTTRQTQQHSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQT    211 - 280
SHVYMPISSPTTSQPPTIHSSGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSS    281 - 350
TSSSVNSQTLNRNQPTVYIAASPPNTDELMSRSQPKVYISANAATGDEQVMRNQPTLFISTNSGASAASR    351 - 420
NMSGQVSMGPAFIHHHPPKSRAIGNNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGVVSPTFELTNL    421 - 490
LNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQKARMERLQRELEIQKKKLDK    491 - 560
LKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNRQLQIDIDCLTKEIDLFQARGPHFNPSAIHN    561 - 630
FYDNIGFVGPVPPKPKDQRSIIKTPKTQDTEDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF           631 - 693
//

Text Mined References (86)

PMID Year Title