Property Summary

NCBI Gene PubMed Count 70
Grant Count 50
R01 Count 37
Funding $2,621,112.03
PubMed Score 69.05
PubTator Score 28.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.600 0.005
ependymoma 1.400 0.017
oligodendroglioma 1.400 0.010
psoriasis -1.300 0.000
osteosarcoma 2.657 0.000
medulloblastoma, large-cell -1.300 0.000
Pick disease 1.300 0.000
ovarian cancer -1.600 0.000
Gaucher disease type 3 -1.100 0.003
dermatomyositis -1.200 0.002

Gene RIF (41)

PMID Text
26432169 DK1 inhibits the formation of the TAK1-TAB2-TRAF6 complex and leads to the inhibition of TRAF6 ubiquitination.
25943894 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of TAB-2
24942571 Authors demonstrate that enterovirus 71 3C interacts with TAB2 and TAK1 and suppresses cytokine expression via cleavage of the TAK1 complex proteins.
24434549 conclude that TRIM38 negatively regulates TNFalpha- and IL-1beta-induced signaling by mediating lysosome-dependent degradation of TAB2/3, two critical components in TNFalpha- and IL-1beta-induced signaling pathways
24096733 SUMOylation may serve as a novel mechanism for the regulation of TAB2.
23818111 These data indicate that overexpression of TRIM22 may negatively regulate the TRAF6-stimulated NF-kappaB pathway by interacting with and degrading TAB2.
22972987 We found that endothelial TAK1 and TAB2, but not TAB1, were critically involved in vascular formation
22660635 MiR-23b suppresses IL-17-, tumor necrosis factor alpha (TNF-alpha)- or IL-1beta-induced NF-kappaB activation and inflammatory cytokine expression by targeting TAB2, TAB3 and IKK-alpha.
22249258 our data implicate Tab2 as a mediator of resistance to endocrine therapy and as a potential new target to reverse pharmacological resistance and potentiate antiestrogen action.
22190034 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of TAB-2
More...

AA Sequence

MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSGISG      1 - 70
LRNHMTSLNLDLQSQNIYHHGREGSRMNGSRTLTHSISDGQLQGGQSNSELFQQEPQTAPAQVPQGFNVF     71 - 140
GMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVTLAPNIQTGRNTPTSLHIHGVPPPVLNSPQG    141 - 210
NSIYIRPYITTPGGTTRQTQQHSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQT    211 - 280
SHVYMPISSPTTSQPPTIHSSGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSS    281 - 350
TSSSVNSQTLNRNQPTVYIAASPPNTDELMSRSQPKVYISANAATGDEQVMRNQPTLFISTNSGASAASR    351 - 420
NMSGQVSMGPAFIHHHPPKSRAIGNNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGVVSPTFELTNL    421 - 490
LNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQKARMERLQRELEIQKKKLDK    491 - 560
LKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNRQLQIDIDCLTKEIDLFQARGPHFNPSAIHN    561 - 630
FYDNIGFVGPVPPKPKDQRSIIKTPKTQDTEDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF           631 - 693
//

Text Mined References (80)

PMID Year Title
26432169 2015 Phosphoinositide-dependent kinase-1 inhibits TRAF6 ubiquitination by interrupting the formation of TAK1-TAB2 complex in TLR4 signaling.
25260751 2014 The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
24942571 2014 Enterovirus 71 3C inhibits cytokine expression through cleavage of the TAK1/TAB1/TAB2/TAB3 complex.
24498425 2014 TAK1 binding protein 2 is essential for liver protection from stressors.
24434549 2014 TRIM38 inhibits TNF?- and IL-1?-triggered NF-?B activation by mediating lysosome-dependent degradation of TAB2/3.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24096733 2014 TAB2, an important upstream adaptor of interleukin-1 signaling pathway, is subject to SUMOylation.
23818111 2013 TRIM22 inhibits the TRAF6-stimulated NF-?B pathway by targeting TAB2 for degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...