Property Summary

NCBI Gene PubMed Count 17
Grant Count 14
R01 Count 13
Funding $1,304,658.69
PubMed Score 42.69
PubTator Score 45.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 2.900 0.008
oligodendroglioma 2.600 0.005
medulloblastoma, large-cell 1.500 0.002
pediatric high grade glioma 1.100 0.046
pilocytic astrocytoma 1.100 0.003
sonic hedgehog group medulloblastoma 2.200 0.001

Gene RIF (7)

PMID Text
23337976 DLL3 was silenced by methylation in human human hepatocellular carcinoma and it negatively regulates the growth of human hepatocellular carcinoma cells.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
18676613 The intracellular region of Notch ligands Dll1 and Dll3 regulates their trafficking and signaling activity
15717203 no novel or previously described mutations are present in our cohort, indicating that DLL3 mutations may not be a major cause of congenital scoliosis.
12746394 mutations in DLL3 cause a consistent pattern of abnormal vertebral segmentation in spondylocostal dysostosis
11923214 We suggest that the three human DLL3 mutations associated with spondylocostal dysplasia are also functionally equivalent to the Dll3(neo) null allele in mice.

AA Sequence

MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSE      1 - 70
EAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAW     71 - 140
SLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPL    141 - 210
EDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDG    211 - 280
NPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNC    281 - 350
EKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALG    351 - 420
FGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQR    421 - 490
YLLPPALGLLVAAGVAGAALLLVHVRRRGHSQDAGSRLLAGTPEPSVHALPDALNNLRTQEGSGDGPSSS    491 - 560
VDWNRPEDVDPQGIYVISAPSIYAREVATPLFPPLHTGRAGQRQHLLFPYPSSILSVK                561 - 618
//

Text Mined References (17)

PMID Year Title
23337976 2013 Delta-like 3 is silenced by methylation and induces apoptosis in human hepatocellular carcinoma.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
18676613 2008 The intracellular region of Notch ligands Dll1 and Dll3 regulates their trafficking and signaling activity.
18485326 2008 Mutations in the MESP2 gene cause spondylothoracic dysostosis/Jarcho-Levin syndrome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15717203 2005 Molecular analysis of congenital scoliosis: a candidate gene approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15200511 2004 Pseudodominant inheritance of spondylocostal dysostosis type 1 caused by two familial delta-like 3 mutations.
More...