Property Summary

NCBI Gene PubMed Count 20
PubMed Score 48.65
PubTator Score 45.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 2.900 7.5e-03
Astrocytoma, Pilocytic 1.100 1.7e-03
medulloblastoma, large-cell 1.400 4.2e-03
oligodendroglioma 2.600 4.8e-03
pediatric high grade glioma 1.100 4.6e-02
sonic hedgehog group medulloblastoma 2.200 6.4e-04

Gene RIF (10)

AA Sequence

MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSE      1 - 70
EAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAW     71 - 140
SLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPL    141 - 210
EDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDG    211 - 280
NPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNC    281 - 350
EKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALG    351 - 420
FGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQR    421 - 490
YLLPPALGLLVAAGVAGAALLLVHVRRRGHSQDAGSRLLAGTPEPSVHALPDALNNLRTQEGSGDGPSSS    491 - 560
VDWNRPEDVDPQGIYVISAPSIYAREVATPLFPPLHTGRAGQRQHLLFPYPSSILSVK                561 - 618
//

Text Mined References (20)

PMID Year Title