Property Summary

NCBI Gene PubMed Count 19
PubMed Score 17.36
PubTator Score 8.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Amphetamine-Related Disorders 74 0.0 0.0
Glioma 74 0.0 0.0
Disease Target Count
Schizophrenia 1160
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Motor neuron disease 49 0.0 1.9
Disease Target Count Z-score Confidence
Demyelinating polyneuropathy 6 3.31 1.7

Expression

  Differential Expression (30)

Disease log2 FC p
adult high grade glioma -2.500 8.5e-06
aldosterone-producing adenoma -1.095 1.2e-02
astrocytic glioma -2.600 2.9e-03
Astrocytoma, Pilocytic -1.900 9.0e-05
Atopic dermatitis -1.100 1.1e-03
atypical teratoid / rhabdoid tumor -4.500 7.1e-05
chronic kidney disease 1.300 4.5e-02
chronic rhinosinusitis -1.425 1.5e-02
cutaneous lupus erythematosus -1.200 4.3e-03
cystic fibrosis 1.221 1.0e-04
ependymoma -2.700 1.7e-03
Gaucher disease type 1 -1.600 4.5e-02
glioblastoma -1.900 3.2e-05
group 3 medulloblastoma -2.000 1.0e-02
head and neck cancer -1.400 1.0e-02
head and neck cancer and chronic obstruc... -1.300 4.2e-04
interstitial cystitis -1.100 8.2e-04
intraductal papillary-mucinous adenoma (... 1.200 4.2e-03
intraductal papillary-mucinous carcinoma... 1.100 4.5e-02
lung adenocarcinoma 1.400 4.4e-04
malignant mesothelioma -4.300 6.4e-09
medulloblastoma, large-cell -4.300 2.5e-07
non-small cell lung cancer 1.128 1.5e-09
oligodendroglioma -2.300 2.9e-03
osteosarcoma 4.038 2.9e-06
ovarian cancer -4.000 2.7e-09
primitive neuroectodermal tumor -2.200 1.1e-02
psoriasis -1.400 6.7e-05
subependymal giant cell astrocytoma -1.249 1.7e-02
ulcerative colitis -1.100 7.5e-04

Pathway (1)

Gene RIF (6)

AA Sequence

MEGRSAAAETFVWVNNASAHSQSVAKAKYEFLFGRSEGKAPDTSDHGGSTLLPPNVTNEFPEYGTMEEGG      1 - 70
EGLRASLEFDGEALPCHPQEQQGVQPLTGCHSGLDSVTEGPKDVREAPSQSHLKEQSLQPIDSLISALKA     71 - 140
TEARIISGTLQATKVLDQDAVSSFSVQQVEKELDTASRKTQRVNKTLPAGQKNLPEIPLSAEVTTEESFY    141 - 210
LSIQKDLTALLTGDTQAEISQIMNNGRKGAVCVQEPSCPLASLGSSAVTCHSAGSVGFLKEQRSALGREH    211 - 280
PGGCDRSSSMGRPGRVKHVEFQGVEILWTGGDKRETQHPIDFETSLQRTASPDSKESSKVPRHLISSAGL    281 - 350
CNSSSLTENVWDESWKAPSERPGTSSGTFSPVRLDESGEDEVFLQENKQHLEKTPKPERDRERISEQEEH    351 - 420
VKGEDEDILGPGYTEDSTDVYSSQFETILDNTSLYYSAESLETLYSEPDSYFSFEMPLTPMIQQRIKEGG    421 - 490
QFLERTSGGGHQDILSVSADGGIVMGYSSGVTNGLNDASDSIYTKGTPEIAFWGSNAGVKTTRLEAHSEM    491 - 560
GSTEILEKETPENLSNGTSSNVEAAKRLAKRLYQLDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGM    561 - 630
TLDQSLRYFFKAFSLVGETQERERVLIHFSNRYFYCNPDTIASQDGVHCLTCAIMLLNTDLHGHVNIGKK    631 - 700
MTCQEFIANLQGVNEGVDFSKDLLKALYNSIKNEKLEWAVDDEEKKKSPSESTEEKANGTHPKTISRIGS    701 - 770
TTNPFLDIPHDPNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKDEYKPEKALSEE    771 - 840
DLKNAVSVHHALASKATDYEKKPNVFKLKTADWRVLLFQTQSPEEMQGWINKINCVAAVFSAPPFPAAIG    841 - 910
SQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPPDKKVKAKDVDEYKLKDHYLEFEKTR    911 - 980
YEMYVSILKEGGKELLSNDESEAAGLKKSHSSPSLNPDTSPITAKVKRNVSERKDHRPETPSIKQKVT      981 - 1048
//

Text Mined References (22)

PMID Year Title