Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.61
PubTator Score 8.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Amphetamine-Related Disorders 74
Glioma 66
Disease Target Count P-value
non-small cell lung cancer 2798 1.54383148553179E-9
ovarian cancer 8492 2.65757804567737E-9
malignant mesothelioma 3163 6.36852453804093E-9
medulloblastoma, large-cell 6234 2.50427932903682E-7
osteosarcoma 7933 2.91947444548391E-6
adult high grade glioma 2148 8.52942146886326E-6
psoriasis 6685 6.69876958333691E-5
atypical teratoid / rhabdoid tumor 4369 7.07011875901381E-5
pilocytic astrocytoma 3086 8.6021882908538E-5
cystic fibrosis 1670 1.01732131860238E-4
ulcerative colitis 2087 1.65122171302378E-4
head and neck cancer and chronic obstructive pulmonary disease 237 4.16933531465309E-4
lung adenocarcinoma 2714 4.3821473822614E-4
glioblastoma 5572 5.74501317111082E-4
interstitial cystitis 2299 8.22377139075146E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 8.71386015446364E-4
medulloblastoma 1524 9.95137921827613E-4
Atopic dermatitis 944 0.00105618397253554
ependymoma 2514 0.00172269010740711
astrocytic glioma 2241 0.00285083280955708
oligodendroglioma 2849 0.0029386605950761
cutaneous lupus erythematosus 1056 0.00430058860420878
subependymal giant cell astrocytoma 2287 0.00957170907286928
head and neck cancer 270 0.0103105328054339
primitive neuroectodermal tumor 3031 0.0110751498512729
aldosterone-producing adenoma 664 0.0115610991608444
chronic rhinosinusitis 512 0.0154531693482249
Gaucher disease type 1 171 0.0449535756790929
chronic kidney disease 90 0.0451745259724636
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0454069911625321
Disease Target Count Z-score Confidence
Motor neuron disease 39 0.0 1.0
Disease Target Count Z-score Confidence
Demyelinating polyneuropathy 7 3.324 1.7

Expression

Synonym

Accession Q9NYI0 A6NFQ4 E9KL50 Q6B003 Q9Y2F1
Symbols EFA6D
EFA6R
HCA67

Gene

  Ortholog (2)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
25296758 EFA6R regulated ARF6 localization and thereby actin stress fiber loss.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20080650 Observational study of gene-disease association. (HuGE Navigator)
18649358 Observational study of gene-disease association. (HuGE Navigator)
16270321 Down regulated in ovarian cancer or absent in ovarian cancer and impact survival.

AA Sequence

MEGRSAAAETFVWVNNASAHSQSVAKAKYEFLFGRSEGKAPDTSDHGGSTLLPPNVTNEFPEYGTMEEGG      1 - 70
EGLRASLEFDGEALPCHPQEQQGVQPLTGCHSGLDSVTEGPKDVREAPSQSHLKEQSLQPIDSLISALKA     71 - 140
TEARIISGTLQATKVLDQDAVSSFSVQQVEKELDTASRKTQRVNKTLPAGQKNLPEIPLSAEVTTEESFY    141 - 210
LSIQKDLTALLTGDTQAEISQIMNNGRKGAVCVQEPSCPLASLGSSAVTCHSAGSVGFLKEQRSALGREH    211 - 280
PGGCDRSSSMGRPGRVKHVEFQGVEILWTGGDKRETQHPIDFETSLQRTASPDSKESSKVPRHLISSAGL    281 - 350
CNSSSLTENVWDESWKAPSERPGTSSGTFSPVRLDESGEDEVFLQENKQHLEKTPKPERDRERISEQEEH    351 - 420
VKGEDEDILGPGYTEDSTDVYSSQFETILDNTSLYYSAESLETLYSEPDSYFSFEMPLTPMIQQRIKEGG    421 - 490
QFLERTSGGGHQDILSVSADGGIVMGYSSGVTNGLNDASDSIYTKGTPEIAFWGSNAGVKTTRLEAHSEM    491 - 560
GSTEILEKETPENLSNGTSSNVEAAKRLAKRLYQLDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGM    561 - 630
TLDQSLRYFFKAFSLVGETQERERVLIHFSNRYFYCNPDTIASQDGVHCLTCAIMLLNTDLHGHVNIGKK    631 - 700
MTCQEFIANLQGVNEGVDFSKDLLKALYNSIKNEKLEWAVDDEEKKKSPSESTEEKANGTHPKTISRIGS    701 - 770
TTNPFLDIPHDPNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKDEYKPEKALSEE    771 - 840
DLKNAVSVHHALASKATDYEKKPNVFKLKTADWRVLLFQTQSPEEMQGWINKINCVAAVFSAPPFPAAIG    841 - 910
SQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPPDKKVKAKDVDEYKLKDHYLEFEKTR    911 - 980
YEMYVSILKEGGKELLSNDESEAAGLKKSHSSPSLNPDTSPITAKVKRNVSERKDHRPETPSIKQKVT      981 - 1048
//

Text Mined References (21)

PMID Year Title
25296758 2014 Exchange factor EFA6R requires C-terminal targeting to the plasma membrane to promote cytoskeletal rearrangement through the activation of ADP-ribosylation factor 6 (ARF6).
24595857 2014 Genome-wide association study of urinary albumin excretion rate in patients with type 1 diabetes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23776197 2013 Genome-wide association study identifies ephrin type A receptors implicated in paclitaxel induced peripheral sensory neuropathy.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
More...