Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.41
PubTator Score 3.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.161 0.003
lung cancer 1.200 0.010
diabetes mellitus -1.300 0.003
group 3 medulloblastoma 1.200 0.001
Pick disease -1.200 0.000
ovarian cancer -1.700 0.000

Synonym

Accession Q9NYH9 Q8IX96 Q96BL2 Q9NQ91
Symbols HCA66
C17orf40

Gene

 GO Function (1)

Gene RIF (2)

PMID Text
19299467 Stability of the small gamma-tubulin complex requires HCA66, a protein of the centrosome and the nucleolus.
17380155 Results suggest that reduced expression of HCA66, owing to haploinsufficiency of HCA66 gene, could render NF1 microdeleted patients-derived cells less susceptible to apoptosis.

AA Sequence

MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYKIQRRTLFKEDFINYVQYEINLLELIQR      1 - 70
RRTRIGYSFKKDEIENSIVHRVQGVFQRASAKWKDDVQLWLSYVAFCKKWATKTRLSKVFSAMLAIHSNK     71 - 140
PALWIMAAKWEMEDRLSSESARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENP    141 - 210
DYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARR    211 - 280
ELEIESQTEEQPTTKQAKAVEVGRKEERCCAVYEEAVKTLPTEAMWKCYITFCLERFTKKSNSGFLRGKR    281 - 350
LERTMTVFRKAHELKLLSECQYKQLSVSLLCYNFLREALEVAVAGTELFRDSGTMWQLKLQVLIESKSPD    351 - 420
IAMLFEEAFVHLKPQVCLPLWISWAEWSEGAKSQEDTEAVFKKALLAVIGADSVTLKNKYLDWAYRSGGY    421 - 490
KKARAVFKSLQESRPFSVDFFRKMIQFEKEQESCNMANIREYYERALREFGSADSDLWMDYMKEELNHPL    491 - 560
GRPENCGQIYWRAMKMLQGESAEAFVAKHAMHQTGHL                                     561 - 597
//

Text Mined References (15)

PMID Year Title
22434888 2012 Mammalian HCA66 protein is required for both ribosome synthesis and centriole duplication.
19299467 2009 Stability of the small gamma-tubulin complex requires HCA66, a protein of the centrosome and the nucleolus.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17632510 2007 Mutations in RNF135, a gene within the NF1 microdeletion region, cause phenotypic abnormalities including overgrowth.
17380155 2007 Positive regulation of apoptosis by HCA66, a new Apaf-1 interacting protein, and its putative role in the physiopathology of NF1 microdeletion syndrome patients.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16138909 2005 Evidence by expression analysis of candidate genes for congenital heart defects in the NF1 microdeletion interval.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...