Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.03
PubTator Score 3.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.300 2.7e-03
group 3 medulloblastoma 1.200 6.5e-04
lung cancer 1.200 1.0e-02
ovarian cancer -1.700 2.1e-10
Pick disease -1.200 1.4e-05
Waldenstrons macroglobulinemia -1.161 3.2e-03

Synonym

Accession Q9NYH9 Q8IX96 Q96BL2 Q9NQ91
Symbols HCA66
C17orf40

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (2)

AA Sequence

MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYKIQRRTLFKEDFINYVQYEINLLELIQR      1 - 70
RRTRIGYSFKKDEIENSIVHRVQGVFQRASAKWKDDVQLWLSYVAFCKKWATKTRLSKVFSAMLAIHSNK     71 - 140
PALWIMAAKWEMEDRLSSESARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENP    141 - 210
DYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARR    211 - 280
ELEIESQTEEQPTTKQAKAVEVGRKEERCCAVYEEAVKTLPTEAMWKCYITFCLERFTKKSNSGFLRGKR    281 - 350
LERTMTVFRKAHELKLLSECQYKQLSVSLLCYNFLREALEVAVAGTELFRDSGTMWQLKLQVLIESKSPD    351 - 420
IAMLFEEAFVHLKPQVCLPLWISWAEWSEGAKSQEDTEAVFKKALLAVIGADSVTLKNKYLDWAYRSGGY    421 - 490
KKARAVFKSLQESRPFSVDFFRKMIQFEKEQESCNMANIREYYERALREFGSADSDLWMDYMKEELNHPL    491 - 560
GRPENCGQIYWRAMKMLQGESAEAFVAKHAMHQTGHL                                     561 - 597
//

Text Mined References (15)

PMID Year Title