Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.03
PubTator Score 3.78

Knowledge Summary


No data available


  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.300 2.7e-03
group 3 medulloblastoma 1.200 6.5e-04
lung cancer 1.200 1.0e-02
ovarian cancer -1.700 2.1e-10
Pick disease -1.200 1.4e-05
Waldenstrons macroglobulinemia -1.161 3.2e-03

 GO Function (1)

Gene RIF (2)

AA Sequence

GRPENCGQIYWRAMKMLQGESAEAFVAKHAMHQTGHL                                     561 - 597

Text Mined References (15)

PMID Year Title