Property Summary

NCBI Gene PubMed Count 27
PubMed Score 17.94
PubTator Score 16.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Neuronal ceroid lipofuscinosis 2 17 3.019 1.5

Expression

Gene RIF (5)

AA Sequence

MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQ      1 - 70
QHCPMCRQEWKFKE                                                             71 - 84
//

Text Mined References (29)

PMID Year Title