Property Summary

NCBI Gene PubMed Count 26
Grant Count 5
R01 Count 5
Funding $134,964.36
PubMed Score 18.93
PubTator Score 16.22

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NYG5 A8MTT2 B7ZW64 Q502X9 Q9BW64 Q9P0R2 APC11
Symbols APC11
Apc11p
HSPC214

Gene

PANTHER Protein Class (2)

PDB

4UI9   5A31   5G04   5G05   5JG6   2MT5   4R2Y  

Gene RIF (5)

PMID Text
23007976 siRNA targeted against Apc11 could hamper entry into G2/M phase.
20826619 The authors showed, in vitro, a direct interaction between Orf virus anaphase promoting complex regulator and APC2 and its interference with interactions between APC11 and APC2.
19826416 Studies indicate that APC/C(Cdh1) is required to maintain genomic stability.
15256223 Inhibition of APC11 function by H(2)O(2) contributes to the delay in cell cycle progression through mitosis that is characteristic of cells subjected to oxidative stress
11739784 APC2 Cullin protein and APC11 RING protein comprise the minimal ubiquitin ligase module of the anaphase-promoting complex.

AA Sequence

MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQ      1 - 70
QHCPMCRQEWKFKE                                                             71 - 84
//

Text Mined References (28)

PMID Year Title
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
23007976 2012 Knockdown expression of Apc11 leads to cell-cycle distribution reduction in G2/M phase.
21926987 2011 APC15 drives the turnover of MCC-CDC20 to make the spindle assembly checkpoint responsive to kinetochore attachment.
20826619 2010 Orf virus cell cycle regulator, PACR, competes with subunit 11 of the anaphase promoting complex for incorporation into the complex.
19826416 2010 The emerging role of APC/CCdh1 in controlling differentiation, genomic stability and tumor suppression.
18485873 2008 Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16364912 2005 Localization of the coactivator Cdh1 and the cullin subunit Apc2 in a cryo-electron microscopy model of vertebrate APC/C.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...