Property Summary

NCBI Gene PubMed Count 7
PubMed Score 12.02
PubTator Score 12.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.6e-03
Breast cancer -1.200 3.3e-13
breast carcinoma -1.100 9.9e-22
dermatomyositis 1.200 6.1e-04
glioblastoma -1.300 4.5e-05
juvenile dermatomyositis 1.135 9.2e-14
medulloblastoma, large-cell -1.100 1.9e-02
Multiple myeloma 1.136 2.2e-03
non-small cell lung cancer -1.645 4.9e-23
ovarian cancer -2.700 8.9e-08
Waldenstrons macroglobulinemia 1.349 7.3e-03

Synonym

Accession Q9NYF5 D3DQB5 G3V0H9 Q3ZCR0 Q6PGQ2 Q9P0I7
Symbols N61
KHCHP
C5orf5
FAM13B1
ARHGAP49

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MRKSSSPSLSNCNSVLANKIFGIPLDELQQGGHPDNEVPFIVRHVVDYIEEHGGLEQQGLFQVNGNAETV      1 - 70
EWLRQRYDSGEEVDLVKEADVPSAISLLRFFLQELPEPVIPGSLHIHLMQLSQDYNNEDEFGRKLRFLLQ     71 - 140
QLPPVNYSLLKFLCRFLANVASHHEEIWSANSLAAVFGPDVFHIYTDVEDMKEQEIVSRIMAGLLENYYE    141 - 210
FFENEEEDFSSNDLSSITEQVNELSEEEEEDEKLEHIEELPEEGAEKSNDMPEVVQLRMTENILESNSVT    211 - 280
ATSTHISPISILPASTDILERTIRAAVEQHLFDLQSSIDHDLKNLQQQSVVCNNEAESIHCDGEGSNNQI    281 - 350
DIADDIINASESNRDCSKPVASTNLDNEAMQQDCVFENEENTQSVGILLEPCSDRGDSEDGCLEREEYLL    351 - 420
FDSDKLSHLILDSSSKICDLNANTESEVPGGQSVGVQGEAACVSIPHLDLKNVSDGDKWEEPFPAFKSWQ    421 - 490
EDSESGEAQLSPQAGRMNHHPLEEDCPPVLSHRSLDFGQSQRFLHDPEKLDSSSKALSFTRIRRSSFSSK    491 - 560
DEKREDRTPYQLVKKLQKKIRQFEEQFERERNSKPSYSDIAANPKVLKWMTELTKLRKQIKDAKHKNSDG    561 - 630
EFVPQTRPRSNTLPKSFGSSLDHEDEENEDEPKVIQKEKKPSKEATLELILKRLKEKRIERCLPEDIKKM    631 - 700
TKDHLVEEKASLQKSLLYYESQHGRPVTKEERHIVKPLYDRYRLVKQMLTRASITPVLGSPSTKRRGQML    701 - 770
QPIIEGETAHFFEEIKEEEEDGVNLSSELGDMLKTAVQVQSSLENSESDVEENQEKLALDLRLSSSRAAS    771 - 840
MPELLEQLWKARAEKKKLRKTLREFEEAFYQQNGRNAQKEDRVPVLEEYREYKKIKAKLRLLEVLISKQD    841 - 910
SSKSI                                                                     911 - 915
//

Text Mined References (9)

PMID Year Title