Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.30
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
acute myeloid leukemia 783 2.9e-02

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.200 2.9e-02

AA Sequence

MITLITEQLQKQTLDELKCTRFSISLPLPDHADISNCGNSFQLVSEGASWRGLPHCSCAEFQDSLNFSYH      1 - 70
PSGLSLHLRPPSRGNSPKEQPFSQVLRPEPPDPEKLPVPPAPPSKRHCRSLSVPVDLSRWQPVWRPAPSK     71 - 140
LWTPIKHRGSGGGGGPQVPHQSPPKRVSSLRFLQAPSASSQCAPAHRPYSPPFFSLALAQDSSRPCAASP    141 - 210
QSGSWESDAESLSPCPPQRRFSLSPSLGPQASRFLPSARSSPASSPELPWRPRGLRNLPRSRSQPCDLDA    211 - 280
RKTGVKRRHEEDPRRLRPSLDFDKMNQKPYSGGLCLQETAREGSSISPPWFMACSPPPLSASCSPTGGSS    281 - 350
QVLSESEEEEEGAVRWGRQALSKRTLCQRDFGDLDLNLIEEN                                351 - 392
//

Text Mined References (18)

PMID Year Title