Property Summary

NCBI Gene PubMed Count 32
PubMed Score 79.61
PubTator Score 39.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 2.533 1.2e-03
active ulcerative colitis 1.332 3.9e-03
astrocytic glioma -1.500 1.9e-02
atypical teratoid / rhabdoid tumor -1.600 6.3e-03
ependymoma -1.900 1.8e-02
glioblastoma -1.400 1.2e-02
lung cancer 3.100 1.5e-05
medulloblastoma 1.100 3.7e-02
oligodendroglioma -1.300 2.9e-02
ovarian cancer 2.400 8.9e-05
pancreatic cancer 2.100 2.1e-03
primary pancreatic ductal adenocarcinoma 2.378 2.1e-03
psoriasis -1.600 2.2e-03
subependymal giant cell astrocytoma -3.485 1.2e-03
tuberculosis and treatment for 6 months 1.300 3.0e-04
X-linked cerebral adrenoleukodystrophy 4.100 9.5e-03

 GWAS Trait (1)

Gene RIF (25)

AA Sequence

MKPSPAGTAKELEPPAPARGEQRTAEPEGRWREKGEADTERQRTRERQEATLAGLAELEYLRQRQELLVR      1 - 70
GALRGAGGAGAAAPRAGELLGEAAQRSRLEEKFLEENILLLRKQLNCLRRRDAGLLNQLQELDKQISDLR     71 - 140
LDVEKTSEEHLETDSRPSSGFYELSDGASGSLSNSSNSVFSECLSSCHSSTCFCSPLEATLSLSDGCPKS    141 - 210
ADLIGLLEYKEGHCEDQASGAVCRSLSTPQFNSLDVIADVNPKYQCDLVSKNGNDVYRYPSPLHAVAVQS    211 - 280
PMFLLCLTGNPLREEDRLGNHASDICGGSELDAVKTDSSLPSPSSLWSASHPSSSKKMDGYILSLVQKKT    281 - 350
HPVRTNKPRTSVNADPTKGLLRNGSVCVRAPGGVSQGNSVNLKNSKQACLPSGGIPSLNNGTFSPPKQWS    351 - 420
KESKAEQAESKRVPLPEGCPSGAASDLQSKHLPKTAKPASQEHARCSAIGTGESPKESAQLSGASPKESP    421 - 490
SRGPAPPQENKVVQPLKKMSQKNSLQGVPPATPPLLSTAFPVEERPALDFKSEGSSQSLEEAHLVKAQFI    491 - 560
PGQQPSVRLHRGHRNMGVVKNSSLKHRGPALQGLENGLPTVREKTRAGSKKCRFPDDLDTNKKLKKASSK    561 - 630
GRKSGGGPEAGVPGRPAGGGHRAGSRAHGHGREAVVAKPKHKRTDYRRWKSSAEISYEEALRRARRGRRE    631 - 700
NVGLYPAPVPLPYASPYAYVASDSEYSAECESLFHSTVVDTSEDEQSNYTTNCFGDSESSVSEGEFVGES    701 - 770
TTTSDSEESGGLIWSQFVQTLPIQTVTAPDLHNHPAKTFVKIKASHNLKKKILRFRSGSLKLMTTV        771 - 836
//

Text Mined References (34)

PMID Year Title