Property Summary

NCBI Gene PubMed Count 27
Grant Count 29
R01 Count 22
Funding $2,690,133.22
PubMed Score 75.14
PubTator Score 39.45

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
26099026 Dact1 has a critical role in the ability support keratinocyte proliferation, by attenuating Wnt/beta catenin signaling.
25825496 Dpr1 promotes the ubiquitination of Dvl2 by pVHL and mediates the protein aggregate-elicited autophagy initiation
25558878 Overexpression of Dapper-1 allows the translocation of MIZ-1 from the nucleus to the cytoplasm.
25524937 There was no statistical difference between groups concerning DACT1 and DACT2 either in promoter hypermethylation or transcript levels. Age was associated with DACT2 promoter hypermethylation, especially over 56 years old.
25424899 our results suggested that DACT1 was upregulated during human placenta development.
24980960 Dpr1 directly interacts with Beclin1 and Atg14L and enhances the Beclin1-Vps34 interaction and Vps34 activity.
23696638 Data indicate that Sestd1 cooperates with Dact1 in Vangl2 regulation and in the planar cell polarity (PCP) pathway during mammalian embryonic development.
23073659 These findings provided insight into the role of DACT1 as a novel functional tumor suppressor in gastric cancer through inhibiting NF-kappaB signaling pathway.
22610794 five missense heterozygote mutations of the DACT1 gene are specifically identified in 167 stillborn or miscarried Han Chinese fetuses with neural tube defects.
22470507 DACT1 stabilizes beta-catenin via DACT1-induced effects on GSK-3beta and directly interacts with beta-catenin proteins.
More...

AA Sequence

MKPSPAGTAKELEPPAPARGEQRTAEPEGRWREKGEADTERQRTRERQEATLAGLAELEYLRQRQELLVR      1 - 70
GALRGAGGAGAAAPRAGELLGEAAQRSRLEEKFLEENILLLRKQLNCLRRRDAGLLNQLQELDKQISDLR     71 - 140
LDVEKTSEEHLETDSRPSSGFYELSDGASGSLSNSSNSVFSECLSSCHSSTCFCSPLEATLSLSDGCPKS    141 - 210
ADLIGLLEYKEGHCEDQASGAVCRSLSTPQFNSLDVIADVNPKYQCDLVSKNGNDVYRYPSPLHAVAVQS    211 - 280
PMFLLCLTGNPLREEDRLGNHASDICGGSELDAVKTDSSLPSPSSLWSASHPSSSKKMDGYILSLVQKKT    281 - 350
HPVRTNKPRTSVNADPTKGLLRNGSVCVRAPGGVSQGNSVNLKNSKQACLPSGGIPSLNNGTFSPPKQWS    351 - 420
KESKAEQAESKRVPLPEGCPSGAASDLQSKHLPKTAKPASQEHARCSAIGTGESPKESAQLSGASPKESP    421 - 490
SRGPAPPQENKVVQPLKKMSQKNSLQGVPPATPPLLSTAFPVEERPALDFKSEGSSQSLEEAHLVKAQFI    491 - 560
PGQQPSVRLHRGHRNMGVVKNSSLKHRGPALQGLENGLPTVREKTRAGSKKCRFPDDLDTNKKLKKASSK    561 - 630
GRKSGGGPEAGVPGRPAGGGHRAGSRAHGHGREAVVAKPKHKRTDYRRWKSSAEISYEEALRRARRGRRE    631 - 700
NVGLYPAPVPLPYASPYAYVASDSEYSAECESLFHSTVVDTSEDEQSNYTTNCFGDSESSVSEGEFVGES    701 - 770
TTTSDSEESGGLIWSQFVQTLPIQTVTAPDLHNHPAKTFVKIKASHNLKKKILRFRSGSLKLMTTV        771 - 836
//

Text Mined References (29)

PMID Year Title
26099026 2015 Dact1 Regulates the Ability of 3T3-J2 Cells to Support Proliferation of Human Epidermal Keratinocytes.
25825496 2015 The Wnt Signaling Antagonist Dapper1 Accelerates Dishevelled2 Degradation via Promoting Its Ubiquitination and Aggregate-induced Autophagy.
25558878 2015 Myc-interacting zinc-finger protein 1 positively regulates Wnt signalling by protecting Dishevelled from Dapper1-mediated degradation.
25524937 2015 Expression and epigenetic regulation of DACT1 and DACT2 in oral squamous cell carcinoma.
25424899 2015 DACT1 is involved in human placenta development by promoting Wnt signaling.
24980960 2014 Dapper1 promotes autophagy by enhancing the Beclin1-Vps34-Atg14L complex formation.
23696638 2013 SEC14 and spectrin domains 1 (Sestd1) and Dapper antagonist of catenin 1 (Dact1) scaffold proteins cooperatively regulate the Van Gogh-like 2 (Vangl2) four-pass transmembrane protein and planar cell polarity (PCP) pathway during embryonic development in mice.
23073659 2012 Dapper homolog 1 is a novel tumor suppressor in gastric cancer through inhibiting the nuclear factor-?B signaling pathway.
22610794 2012 Identification of novel rare mutations of DACT1 in human neural tube defects.
22470507 2012 Oncogenic function of DACT1 in colon cancer through the regulation of ?-catenin.
More...