Property Summary

NCBI Gene PubMed Count 27
PubMed Score 20.41
PubTator Score 18.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 1.6725752028232E-12
juvenile dermatomyositis 1189 6.52119437810379E-11
atypical teratoid / rhabdoid tumor 4369 8.5186808431385E-10
ovarian cancer 8492 3.25100449015323E-8
osteosarcoma 7933 7.60616485578328E-7
malignant mesothelioma 3163 2.67042913921212E-6
tuberculosis 1563 3.07531403788193E-5
medulloblastoma, large-cell 6234 6.42739350668585E-5
lung cancer 4473 7.77136238945502E-5
psoriasis 6685 1.26927800494364E-4
glioblastoma 5572 1.36195431019142E-4
chronic rhinosinusitis 512 0.00128050869377256
pediatric high grade glioma 2712 0.00282321871642386
spina bifida 1064 0.0228948211056843
ependymoma 2514 0.0332744355256521
acute myeloid leukemia 785 0.0369619969512773
Hydrolethalus syndrome 128 0.0385446835932828
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0464152813865062
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0477329206732492
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Atherosclerosis 275 0.0 2.0

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
ependymoma -1.100 0.033
psoriasis 1.300 0.000
osteosarcoma 2.013 0.000
atypical teratoid / rhabdoid tumor 2.000 0.000
glioblastoma 1.700 0.000
medulloblastoma, large-cell -1.700 0.000
juvenile dermatomyositis 1.010 0.000
tuberculosis -1.300 0.000
intraductal papillary-mucinous adenoma (... 1.400 0.048
intraductal papillary-mucinous neoplasm ... 2.000 0.046
Hydrolethalus syndrome 1.486 0.039
lung cancer 1.700 0.000
pediatric high grade glioma 1.200 0.003
spina bifida 1.122 0.023
Breast cancer -1.100 0.000
acute myeloid leukemia -1.400 0.037
ovarian cancer -2.200 0.000
chronic rhinosinusitis -1.047 0.001

Synonym

Accession Q9NYB9 B4DSN1 Q13147 Q13249 Q13801 Q9BV70
Symbols ABI-2
ABI2B
AIP-1
AblBP3
argBP1
SSH3BP2
argBPIA
argBPIB

Gene

PANTHER Protein Class (2)

PDB

3P8C   4N78   2ED0  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG

Gene RIF (6)

PMID Text
22304832 Abl-interactor 2 (ABI2) is a novel MLL translocation partner in acute myeloid leukemia.
19158278 These findings uncover a novel link between cadherin-mediated adhesion and the regulation of actin dynamics through the requirement for an Abi/Dia complex for the formation and stability of cell-cell junctions.
18632609 TRIM32 is a novel oncogene that promotes tumor growth, metastasis, and resistance to anticancer drugs via degradation of Abl-interactor 2
17389688 disruption of the interaction between Bcr-Abl and Abi1 by mutations either in Bcr-Abl or Abi1 not only abolished tyrosine phosphorylation of Abi1 and membrane translocation of Abi1/WAVE2
17101133 NESH (Abi-3), like Abi-1 and Abi-2, is a component of the Abi/WAVE complex, but likely plays a different role in the regulation of c-Abl.
16488906 Abi-2 may have a key regulatory function in leiomyomas cellular/tissue structural organization during growth and regression

AA Sequence

MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLAN      1 - 70
NVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKP     71 - 140
IDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPVVP    141 - 210
NDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPS    211 - 280
VFPAPAGSAGTPPLPATSASAPAPLVPATVPSSTAPNAAAGGAPNLADGFTSPTPPVVSSTPPTGHPVQF    281 - 350
YSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYSQNPVSDTPPPPPPVEEPVFDESPPPP    351 - 420
PPPEDYEEEEAAVVEYSDPYAEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYE    421 - 490
GVMNGVTGLFPGNYVESIMHYSE                                                   491 - 513
//

Text Mined References (33)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25121749 2014 HCMV pUL135 remodels the actin cytoskeleton to impair immune recognition of infected cells.
24439377 2014 Local F-actin network links synapse formation and axon branching.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22304832 2012 Abl-interactor 2 (ABI2): a novel MLL translocation partner in acute myeloid leukemia.
21862451 2011 GWAS of butyrylcholinesterase activity identifies four novel loci, independent effects within BCHE and secondary associations with metabolic risk factors.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21107423 2010 Structure and control of the actin regulatory WAVE complex.
More...