Property Summary

NCBI Gene PubMed Count 27
Grant Count 30
R01 Count 23
Funding $1,180,669.45
PubMed Score 20.41
PubTator Score 18.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
ependymoma -1.100 0.033
psoriasis 1.300 0.000
osteosarcoma 2.013 0.000
atypical teratoid / rhabdoid tumor 2.000 0.000
glioblastoma 1.700 0.000
medulloblastoma, large-cell -1.700 0.000
juvenile dermatomyositis 1.010 0.000
tuberculosis -1.300 0.000
intraductal papillary-mucinous adenoma (... 1.400 0.048
intraductal papillary-mucinous neoplasm ... 2.000 0.046
Hydrolethalus syndrome 1.486 0.039
lung cancer 1.700 0.000
pediatric high grade glioma 1.200 0.003
spina bifida 1.122 0.023
Breast cancer -1.100 0.000
acute myeloid leukemia -1.400 0.037
ovarian cancer -2.200 0.000
chronic rhinosinusitis -1.047 0.001

Gene RIF (6)

PMID Text
22304832 Abl-interactor 2 (ABI2) is a novel MLL translocation partner in acute myeloid leukemia.
19158278 These findings uncover a novel link between cadherin-mediated adhesion and the regulation of actin dynamics through the requirement for an Abi/Dia complex for the formation and stability of cell-cell junctions.
18632609 TRIM32 is a novel oncogene that promotes tumor growth, metastasis, and resistance to anticancer drugs via degradation of Abl-interactor 2
17389688 disruption of the interaction between Bcr-Abl and Abi1 by mutations either in Bcr-Abl or Abi1 not only abolished tyrosine phosphorylation of Abi1 and membrane translocation of Abi1/WAVE2
17101133 NESH (Abi-3), like Abi-1 and Abi-2, is a component of the Abi/WAVE complex, but likely plays a different role in the regulation of c-Abl.
16488906 Abi-2 may have a key regulatory function in leiomyomas cellular/tissue structural organization during growth and regression

AA Sequence

MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLAN      1 - 70
NVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKP     71 - 140
IDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPVVP    141 - 210
NDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPS    211 - 280
VFPAPAGSAGTPPLPATSASAPAPLVPATVPSSTAPNAAAGGAPNLADGFTSPTPPVVSSTPPTGHPVQF    281 - 350
YSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYSQNPVSDTPPPPPPVEEPVFDESPPPP    351 - 420
PPPEDYEEEEAAVVEYSDPYAEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYE    421 - 490
GVMNGVTGLFPGNYVESIMHYSE                                                   491 - 513
//

Text Mined References (33)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25121749 2014 HCMV pUL135 remodels the actin cytoskeleton to impair immune recognition of infected cells.
24439377 2014 Local F-actin network links synapse formation and axon branching.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22304832 2012 Abl-interactor 2 (ABI2): a novel MLL translocation partner in acute myeloid leukemia.
21862451 2011 GWAS of butyrylcholinesterase activity identifies four novel loci, independent effects within BCHE and secondary associations with metabolic risk factors.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21107423 2010 Structure and control of the actin regulatory WAVE complex.
More...