Property Summary

Ligand Count 12
NCBI Gene PubMed Count 83
PubMed Score 5.75
PubTator Score 37.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
dermatomyositis 1.100 2.9e-04
glioblastoma -1.100 7.8e-05
lung carcinoma 1.400 1.0e-24
ovarian cancer -2.100 1.3e-11
Pick disease -1.100 1.3e-03
subependymal giant cell astrocytoma -1.119 3.4e-03

Gene RIF (44)

AA Sequence

MAEAMDLGKDPNGPTHSSTLFVRDDGSSMSFYVRPSPAKRRLSTLILHGGGTVCRVQEPGAVLLAQPGEA      1 - 70
LAEASGDFISTQYILDCVERNERLELEAYRLGPASAADTGSEAKPGALAEGAAEPEPQRHAGRIAFTDAD     71 - 140
DVAILTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHKYLLGDAPVSPSSQKLK    141 - 210
RKAEEDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEVVVDESPPDFEIHITMC    211 - 280
DDDPPTPEEDSETQPDEEEEEEEEKVSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFL    281 - 350
ASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVARRIEFRKK                         351 - 399
//

Text Mined References (99)

PMID Year Title