Property Summary

NCBI Gene PubMed Count 75
Grant Count 1
Funding $3,856.83
PubMed Score 5.60
PubTator Score 37.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma -1.100 0.000
subependymal giant cell astrocytoma -1.119 0.003
lung carcinoma 1.400 0.000
Pick disease -1.100 0.001
ovarian cancer -2.100 0.000
dermatomyositis 1.100 0.000

Gene

 Grant Application (1)

PDB

1FEX   3K6G   4RQI  

Gene RIF (39)

PMID Text
26748096 Through a combination of biochemical, biophysical and structural approaches, we unveiled a unique mode of assembly between RAP1 and TRF2
26505215 In pro-inflammatory macrophages, Rap1 promotes cytokine production via NFkappaB activation favoring a pro-inflammatory environment which may contribute to the development and progression of atherosclerosis.
26327598 Data indicate telomere-binding protein RAP1 as an interacting partner of isoform beta2 of the heregulin (HRGbeta2).
26318724 Data show that isoform beta2 of the heregulin (HRGbeta2) localizes at telomeres with the telomere-associated proteins TRF2 and RAP1.
25675958 Data show that full-length repressor activator protein 1 (Rap1) binds to full-length telomeric repeat binding factor 2 (TRF2) with high affinity and equimolar ratio.
25617801 C3G/RAP1 activity is involved in the metastatic spread of epithelial ovarian cancer.
25505254 Nonsense mutations in the TERF2IP gene in familial melanoma: four families carried TERF2IP variants, which included nonsense mutations in both genes (p.Q320X and p.R364X, respectively).
25453752 the conservation of Rap1 reflects its role in transcriptional regulation rather than a function at telomeres.
25447308 a detailed analysis of individual focal adhesion parameters identified focal adhesion size, sliding and intensity as primary targets of Rap1.
25208567 These findings reveal Pkp3 as a coordinator of desmosome and adherens junction assembly and maturation through its functional association with Rap1.
More...

AA Sequence

MAEAMDLGKDPNGPTHSSTLFVRDDGSSMSFYVRPSPAKRRLSTLILHGGGTVCRVQEPGAVLLAQPGEA      1 - 70
LAEASGDFISTQYILDCVERNERLELEAYRLGPASAADTGSEAKPGALAEGAAEPEPQRHAGRIAFTDAD     71 - 140
DVAILTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHKYLLGDAPVSPSSQKLK    141 - 210
RKAEEDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEVVVDESPPDFEIHITMC    211 - 280
DDDPPTPEEDSETQPDEEEEEEEEKVSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFL    281 - 350
ASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVARRIEFRKK                         351 - 399
//

Text Mined References (90)

PMID Year Title
26748096 2016 A higher-order entity formed by the flexible assembly of RAP1 with TRF2.
26505215 2015 Rap1 induces cytokine production in pro-inflammatory macrophages through NF?B signaling and is highly expressed in human atherosclerotic lesions.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26327598 2015 Heregulin, a new interactor of the telosome/shelterin complex in human telomeres.
26318724 2015 Heregulin, a new regulator of telomere length in human cells.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25675958 2015 Human Rap1 modulates TRF2 attraction to telomeric DNA.
25620558 2015 TRF2 recruits RTEL1 to telomeres in S phase to promote t-loop unwinding.
25617801 2015 The C3G/Rap1 pathway promotes secretion of MMP-2 and MMP-9 and is involved in serous ovarian cancer metastasis.
25505254 2015 Nonsense mutations in the shelterin complex genes ACD and TERF2IP in familial melanoma.
More...