Property Summary

NCBI Gene PubMed Count 188
Grant Count 223
R01 Count 88
Funding $17,953,124.81
PubMed Score 514.08
PubTator Score 400.59

Knowledge Summary

Patent (18,734)

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.900 0.000
osteosarcoma 1.518 0.010
posterior fossa group A ependymoma 1.600 0.000
glioblastoma 1.700 0.001
tuberculosis -2.300 0.000
intraductal papillary-mucinous adenoma (... -1.200 0.000
cystic fibrosis 1.200 0.000
pediatric high grade glioma 1.400 0.000
sonic hedgehog group medulloblastoma 2.200 0.000
ovarian cancer 1.100 0.023

Synonym

Accession Q9NYA1 Q8N632 Q96GK1 Q9HD92 Q9NY70 Q9NYL3 SK 1
Symbols SPHK

Gene

PDB

3VZB   3VZC   3VZD   4L02   4V24  

Gene RIF (170)

PMID Text
26886371 increased SK and SPL mRNA expression along with reduced sphingosine 1-phosphate levels were more commonly observed in hepatocellular carcinoma tissues.
26842184 Sphk1 plays an important role in the malignant transformation of breast epithelial cells and modulates breast cancer metastasis through the regulation of Ecadherin expression.
26716409 High SPHK1 expression is associated with ovarian cancer.
26590717 Results reveal an lncRNA- and E2F1-driven regulatory loop in which E2F1-dependent induction of antisense RNA leads to changes in chromatin structure, facilitating E2F1-dependent expression of SPHK1 and restriction of E2F1-induced apoptosis.
26549227 MiR-506 suppresses the angiogenesis of liver cancer by inhibiting SPHK1.
26540633 Data show that long non-coding RNA HULC promotes tumor angiogenesis in liver cancer through microRNA miR-107/E2F1 transcription factor (E2F1)/sphingosine kinase 1 (SPHK1) signaling.
26493335 High SPHK1 protein correlated with resistance to cisplatin (IC50) in an independent gastric cancer cell line panel and with survival of patients treated with chemotherapy prior to surgery but not in patients treated with surgery alone.
26376826 In summary, this study demonstrates a link between SphK1/sphingosine-1-phosphate and TGF-beta-induced miR-21 in renal tubular epithelial cells.
26311741 SPHK1 is involved in tumor development and progression of cervical cancer
26264277 The silencing of SphK1 potentiated the apoptotic effects of the green tea polyphenol epigallocatechin-3-O-gallate.
More...

AA Sequence

MDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHARELVRSEELG      1 - 70
RWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTL     71 - 140
LLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLESEKYRRLGEMRFTLGTFLRLAALRTYRGRL    141 - 210
AYLPVGRVGSKTPASPVVVQQGPVDAHLVPLEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRC    211 - 280
AAGVMHLFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAV    281 - 350
QGQVHPNYFWMVSGCVEPPPSWKPQQMPPPEEPL                                        351 - 384
//

Text Mined References (191)

PMID Year Title
26886371 2016 Increased mRNA Levels of Sphingosine Kinases and S1P Lyase and Reduced Levels of S1P Were Observed in Hepatocellular Carcinoma in Association with Poorer Differentiation and Earlier Recurrence.
26842184 Role of Sphk1 in the malignant transformation of breast epithelial cells and breast cancer progression.
26716409 2016 Sphingosine kinase 1 is required for TGF-? mediated fibroblastto- myofibroblast differentiation in ovarian cancer.
26590717 2015 LncRNA Khps1 Regulates Expression of the Proto-oncogene SPHK1 via Triplex-Mediated Changes in Chromatin Structure.
26549227 2015 MiR-506 suppresses liver cancer angiogenesis through targeting sphingosine kinase 1 (SPHK1) mRNA.
26540633 2016 Long non-coding RNA HULC promotes tumor angiogenesis in liver cancer by up-regulating sphingosine kinase 1 (SPHK1).
26493335 2015 Regulation of cellular sphingosine-1-phosphate by sphingosine kinase 1 and sphingosine-1-phopshate lyase determines chemotherapy resistance in gastroesophageal cancer.
26376826 2016 Transforming growth factor-?-sphingosine kinase 1/S1P signaling upregulates microRNA-21 to promote fibrosis in renal tubular epithelial cells.
26311741 2015 Sphingosine kinase 1 is a reliable prognostic factor and a novel therapeutic target for uterine cervical cancer.
26264277 2015 Sphingosine Kinase-1 Protects Multiple Myeloma from Apoptosis Driven by Cancer-Specific Inhibition of RTKs.
More...