| Tbio | N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 |
Beta-1,3-N-acetylglucosaminyltransferase involved in the synthesis of poly-N-acetyllactosamine. Catalyzes the initiation and elongation of poly-N-acetyllactosamine chains. Shows a marked preference for Gal(beta1-4)Glc(NAc)-based acceptors (PubMed:9892646). Probably constitutes the main polylactosamine synthase.
This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2016]
This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2016]
Comments
Property Summary
| NCBI Gene PubMed Count | 23 |
| Grant Count | 91 |
| R01 Count | 71 |
| Funding | $9,557,065.42 |
| PubMed Score | 30.88 |
| PubTator Score | 542.05 |
| Disease | log2 FC | p |
|---|---|---|
| pancreatic cancer | -1.200 | 0.005 |
| malignant mesothelioma | -1.300 | 0.000 |
| astrocytic glioma | -1.300 | 0.004 |
| oligodendroglioma | -1.700 | 0.003 |
| osteosarcoma | 1.475 | 0.002 |
| group 3 medulloblastoma | -1.500 | 0.043 |
| juvenile dermatomyositis | 1.098 | 0.000 |
| Breast cancer | 2.900 | 0.037 |
| primary Sjogren syndrome | 1.200 | 0.009 |
| pancreatic carcinoma | -1.200 | 0.005 |
| ductal carcinoma in situ | 1.100 | 0.001 |
| invasive ductal carcinoma | 1.100 | 0.004 |
| ovarian cancer | 2.200 | 0.002 |
| PMID | Text |
|---|---|
| 25605193 | High B3GNT2 expression is associated with hepatocellular carcinoma. |
| 24998922 | data reveals beta3GnT2 and polyLacNAc may be involved in the progression of the pre-malignant lesions of human the uterine cervix. |
| 18826941 | up-regulation of beta3Gn-T8 in differentiated cells increases poly-N-acetyllactosamine chains by activating intrinsic beta3Gn-T2. |
| 15560372 | beta1, 3-N-acetylglucosaminyltransferase is similar to a new protein, beta3-GnTL1 |
| 14686931 | beta 3Gal-T5 plays a relevant role in gastrointestinal and pancreatic tissues counteracting the glycosylation pattern associated with malignancy |
| 14555842 | beta3Gal-T5 is presumed to be responsible for the synthesis of CA 19-9 in pancreatic cancer tissue. |
| 12855703 | beta3Gal-T5, controlled by the intestinal homeoproteins, may play an important role in the specific function of intestinal cells by modifying the carbohydrate structure of glycoproteins |
MSVGRRRIKLLGILMMANVFIYFIMEVSKSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQY 1 - 70 NPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAK 71 - 140 KPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILM 141 - 210 WNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAG 211 - 280 PHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKH 281 - 350 KGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC 351 - 397 //
| PMID | Year | Title |
|---|---|---|
| 25605193 | 2014 | B3GNT2, a polylactosamine synthase, regulates glycosylation of EGFR in H7721 human hepatocellular carcinoma cells. |
| 25279697 | 2014 | B4GAT1 is the priming enzyme for the LARGE-dependent functional glycosylation of ?-dystroglycan. |
| 24998922 | 2014 | Differential expression patterns of N-acetylglucosaminyl transferases and polylactosamines in uterine lesions. |
| 24390342 | 2014 | Genetics of rheumatoid arthritis contributes to biology and drug discovery. |
| 23376485 | 2013 | Proteomic analysis of podocyte exosome-enriched fraction from normal human urine. |
| 22446963 | 2012 | Meta-analysis identifies nine new loci associated with rheumatoid arthritis in the Japanese population. |
| 21926972 | 2011 | Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4. |
| 20062062 | 2010 | Genome-wide association study of ankylosing spondylitis identifies non-MHC susceptibility loci. |
| 18826941 | 2008 | Activation of beta1,3-N-acetylglucosaminyltransferase-2 (beta3Gn-T2) by beta3Gn-T8. Possible involvement of beta3Gn-T8 in increasing poly-N-acetyllactosamine chains in differentiated HL-60 cells. |
| 17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. |
| More... |
