Tbio | N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 |
Beta-1,3-N-acetylglucosaminyltransferase involved in the synthesis of poly-N-acetyllactosamine. Catalyzes the initiation and elongation of poly-N-acetyllactosamine chains. Shows a marked preference for Gal(beta1-4)Glc(NAc)-based acceptors (PubMed:9892646). Probably constitutes the main polylactosamine synthase.
This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2016]
This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2016]
Comments
Disease | Target Count |
---|---|
Graves Disease | 17 |
Disease | Target Count | P-value |
---|---|---|
juvenile dermatomyositis | 1189 | 9.04008182174422E-8 |
malignant mesothelioma | 3163 | 1.10135340038289E-6 |
ductal carcinoma in situ | 1745 | 5.21771186286023E-4 |
ovarian cancer | 8492 | 0.00162792016904896 |
osteosarcoma | 7933 | 0.00224547125006246 |
oligodendroglioma | 2849 | 0.00279283148801132 |
astrocytic glioma | 2241 | 0.00410578484865703 |
invasive ductal carcinoma | 2950 | 0.00415749165094977 |
pancreatic carcinoma | 567 | 0.00525124723564198 |
pancreatic cancer | 2300 | 0.00525124723564204 |
primary Sjogren syndrome | 789 | 0.0094294368210367 |
Breast cancer | 3099 | 0.0365574649866383 |
group 3 medulloblastoma | 2254 | 0.043028190869527 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Rheumatoid Arthritis | 1171 | 0.0 | 2.0 |
Disease | log2 FC | p |
---|---|---|
pancreatic cancer | -1.200 | 0.005 |
malignant mesothelioma | -1.300 | 0.000 |
astrocytic glioma | -1.300 | 0.004 |
oligodendroglioma | -1.700 | 0.003 |
osteosarcoma | 1.475 | 0.002 |
group 3 medulloblastoma | -1.500 | 0.043 |
juvenile dermatomyositis | 1.098 | 0.000 |
Breast cancer | 2.900 | 0.037 |
primary Sjogren syndrome | 1.200 | 0.009 |
pancreatic carcinoma | -1.200 | 0.005 |
ductal carcinoma in situ | 1.100 | 0.001 |
invasive ductal carcinoma | 1.100 | 0.004 |
ovarian cancer | 2.200 | 0.002 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Opossum | EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
25605193 | High B3GNT2 expression is associated with hepatocellular carcinoma. |
24998922 | data reveals beta3GnT2 and polyLacNAc may be involved in the progression of the pre-malignant lesions of human the uterine cervix. |
18826941 | up-regulation of beta3Gn-T8 in differentiated cells increases poly-N-acetyllactosamine chains by activating intrinsic beta3Gn-T2. |
15560372 | beta1, 3-N-acetylglucosaminyltransferase is similar to a new protein, beta3-GnTL1 |
14686931 | beta 3Gal-T5 plays a relevant role in gastrointestinal and pancreatic tissues counteracting the glycosylation pattern associated with malignancy |
14555842 | beta3Gal-T5 is presumed to be responsible for the synthesis of CA 19-9 in pancreatic cancer tissue. |
12855703 | beta3Gal-T5, controlled by the intestinal homeoproteins, may play an important role in the specific function of intestinal cells by modifying the carbohydrate structure of glycoproteins |
MSVGRRRIKLLGILMMANVFIYFIMEVSKSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQY 1 - 70 NPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAK 71 - 140 KPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILM 141 - 210 WNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAG 211 - 280 PHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKH 281 - 350 KGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC 351 - 397 //
PMID | Year | Title |
---|---|---|
25605193 | 2014 | B3GNT2, a polylactosamine synthase, regulates glycosylation of EGFR in H7721 human hepatocellular carcinoma cells. |
25279697 | 2014 | B4GAT1 is the priming enzyme for the LARGE-dependent functional glycosylation of ?-dystroglycan. |
24998922 | 2014 | Differential expression patterns of N-acetylglucosaminyl transferases and polylactosamines in uterine lesions. |
24390342 | 2014 | Genetics of rheumatoid arthritis contributes to biology and drug discovery. |
23376485 | 2013 | Proteomic analysis of podocyte exosome-enriched fraction from normal human urine. |
22446963 | 2012 | Meta-analysis identifies nine new loci associated with rheumatoid arthritis in the Japanese population. |
21926972 | 2011 | Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4. |
20062062 | 2010 | Genome-wide association study of ankylosing spondylitis identifies non-MHC susceptibility loci. |
18826941 | 2008 | Activation of beta1,3-N-acetylglucosaminyltransferase-2 (beta3Gn-T2) by beta3Gn-T8. Possible involvement of beta3Gn-T8 in increasing poly-N-acetyllactosamine chains in differentiated HL-60 cells. |
17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. |
More... |