Property Summary

NCBI Gene PubMed Count 23
Grant Count 91
R01 Count 71
Funding $9,557,065.42
PubMed Score 30.88
PubTator Score 542.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
pancreatic cancer -1.200 0.005
malignant mesothelioma -1.300 0.000
astrocytic glioma -1.300 0.004
oligodendroglioma -1.700 0.003
osteosarcoma 1.475 0.002
group 3 medulloblastoma -1.500 0.043
juvenile dermatomyositis 1.098 0.000
Breast cancer 2.900 0.037
primary Sjogren syndrome 1.200 0.009
pancreatic carcinoma -1.200 0.005
ductal carcinoma in situ 1.100 0.001
invasive ductal carcinoma 1.100 0.004
ovarian cancer 2.200 0.002

Synonym

Accession Q9NY97 Q54AC1 Q9NQQ9 Q9NQR0 Q9NUT9
Symbols B3GNT
BGNT2
B3GNT1
BGnT-2
beta-1
3-Gn-T1
3-Gn-T2
B3GN-T2
B3GNT-2
BETA3GNT
beta3Gn-T1
beta3Gn-T2

Gene

PANTHER Protein Class (2)

Gene RIF (7)

PMID Text
25605193 High B3GNT2 expression is associated with hepatocellular carcinoma.
24998922 data reveals beta3GnT2 and polyLacNAc may be involved in the progression of the pre-malignant lesions of human the uterine cervix.
18826941 up-regulation of beta3Gn-T8 in differentiated cells increases poly-N-acetyllactosamine chains by activating intrinsic beta3Gn-T2.
15560372 beta1, 3-N-acetylglucosaminyltransferase is similar to a new protein, beta3-GnTL1
14686931 beta 3Gal-T5 plays a relevant role in gastrointestinal and pancreatic tissues counteracting the glycosylation pattern associated with malignancy
14555842 beta3Gal-T5 is presumed to be responsible for the synthesis of CA 19-9 in pancreatic cancer tissue.
12855703 beta3Gal-T5, controlled by the intestinal homeoproteins, may play an important role in the specific function of intestinal cells by modifying the carbohydrate structure of glycoproteins

AA Sequence

MSVGRRRIKLLGILMMANVFIYFIMEVSKSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQY      1 - 70
NPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAK     71 - 140
KPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILM    141 - 210
WNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAG    211 - 280
PHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKH    281 - 350
KGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC                           351 - 397
//

Text Mined References (24)

PMID Year Title
25605193 2014 B3GNT2, a polylactosamine synthase, regulates glycosylation of EGFR in H7721 human hepatocellular carcinoma cells.
25279697 2014 B4GAT1 is the priming enzyme for the LARGE-dependent functional glycosylation of ?-dystroglycan.
24998922 2014 Differential expression patterns of N-acetylglucosaminyl transferases and polylactosamines in uterine lesions.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22446963 2012 Meta-analysis identifies nine new loci associated with rheumatoid arthritis in the Japanese population.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
20062062 2010 Genome-wide association study of ankylosing spondylitis identifies non-MHC susceptibility loci.
18826941 2008 Activation of beta1,3-N-acetylglucosaminyltransferase-2 (beta3Gn-T2) by beta3Gn-T8. Possible involvement of beta3Gn-T8 in increasing poly-N-acetyllactosamine chains in differentiated HL-60 cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...