Property Summary

NCBI Gene PubMed Count 25
PubMed Score 30.44
PubTator Score 542.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.300 4.1e-03
Breast cancer 2.900 3.7e-02
ductal carcinoma in situ 1.100 5.2e-04
group 3 medulloblastoma -1.500 4.3e-02
invasive ductal carcinoma 1.100 4.2e-03
juvenile dermatomyositis 1.098 9.0e-08
malignant mesothelioma -1.300 1.1e-06
oligodendroglioma -1.700 2.8e-03
osteosarcoma 1.475 2.2e-03
ovarian cancer 2.200 1.6e-03
pancreatic cancer -1.200 5.3e-03
pancreatic carcinoma -1.200 5.3e-03
primary Sjogren syndrome 1.200 9.4e-03

Gene RIF (9)

AA Sequence

MSVGRRRIKLLGILMMANVFIYFIMEVSKSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQY      1 - 70
NPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAK     71 - 140
KPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILM    141 - 210
WNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAG    211 - 280
PHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKH    281 - 350
KGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC                           351 - 397
//

Text Mined References (26)

PMID Year Title